KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001029
Entry
103001029         CDS       T03086                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta 3
  KO
K13377  transforming growth factor beta-3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04218  Cellular senescence
bacu04350  TGF-beta signaling pathway
bacu04390  Hippo signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103001029 (TGFB3)
   04350 TGF-beta signaling pathway
    103001029 (TGFB3)
   04390 Hippo signaling pathway
    103001029 (TGFB3)
   04068 FoxO signaling pathway
    103001029 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103001029 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103001029 (TGFB3)
   04218 Cellular senescence
    103001029 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001029 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103001029 (TGFB3)
   05212 Pancreatic cancer
    103001029 (TGFB3)
   05225 Hepatocellular carcinoma
    103001029 (TGFB3)
   05226 Gastric cancer
    103001029 (TGFB3)
   05220 Chronic myeloid leukemia
    103001029 (TGFB3)
   05211 Renal cell carcinoma
    103001029 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103001029 (TGFB3)
   05321 Inflammatory bowel disease
    103001029 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103001029 (TGFB3)
   05414 Dilated cardiomyopathy
    103001029 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103001029 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103001029 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103001029 (TGFB3)
   05161 Hepatitis B
    103001029 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103001029 (TGFB3)
   05144 Malaria
    103001029 (TGFB3)
   05145 Toxoplasmosis
    103001029 (TGFB3)
   05140 Leishmaniasis
    103001029 (TGFB3)
   05142 Chagas disease
    103001029 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103001029 (TGFB3)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103001029 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103001029
NCBI-ProteinID: XP_007184561
UniProt: A0A384AB25
LinkDB
Position
Un
AA seq 456 aa
MHLLAKPQSSGSREAAWFSSLLLHVCWGLLLTRPRSPRASLPCSRMKMHLQRGLVVLALL
NFATVSLSMSTVTTLDFDHIKRKRVEAIRGQILSKLRLTSPPDPSVLANIPTQVLDLYNS
TRELLEEVHGERGDDCTQENTESEYYAKEIYKFDMIQGLEEHNDLAVCPKGITSKIFRFN
VSSVEKNETNLFRAEFRVLRMPNPSSKRSEQRIELFQILQPDEHIAKQRYLDGKNLPTRG
TAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQEVMEIKFKGVDS
EDDPGRGDLGRLKKKKEHSPHLILMMIPPDRLDNPGQGGQRKKRALDTNYCFRNLEENCC
VRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSSVLGLYNTLNPEASASP
CCVPQDLEPLTILYYVGRTAKVEQLSNMVVKSCKCS
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgtctgctggggtctcctcctcaccaggcctcgcagcccccgggcctct
ctcccctgctcacgcatgaagatgcacttgcaaaggggtctggtggtcctggccctgctg
aactttgccacggtcagcctctccatgtccactgtcaccaccttggacttcgaccacatc
aagaggaagcgggtggaagccattaggggacagatcttgagcaaactcaggctcaccagt
ccccccgatccatcggtgttggccaacatccccacccaggtcctggacctttacaacagc
acccgagagctgctggaagaggtgcacggggagaggggagacgactgcactcaggaaaac
accgagtcggagtactatgccaaagaaatctataaattcgacatgatccaggggctggag
gagcacaatgacctggccgtctgtcccaaaggaatcacctccaagattttccgcttcaac
gtgtcctcagtggagaaaaatgaaaccaacctgttccgagcggaattccgggtcttgcgg
atgcccaaccccagctccaagcgcagcgagcagaggattgagctcttccagatcctccag
ccggatgagcacatagccaagcagcgctatcttgatggcaagaatctgcccacgcggggc
actgctgagtggctgtctttcgacgtcacagacactgtgcgtgaatggctcttacgaaga
gaatccaacttaggtctggaaatcagcattcattgtccatgtcacacctttcagcccaat
ggggatatcctggaaaacattcaagaggtgatggaaatcaaattcaaaggtgtggacagt
gaggatgatccaggccgaggagatctggggcgactgaagaagaaaaaggagcacagccct
catttaatcctcatgatgattcccccagaccggctggacaacccaggccagggaggtcag
aggaagaagcgggccctggacaccaattactgcttccgcaatctggaggagaactgctgt
gtgcgccctctctacattgacttccgacaggatctgggctggaaatgggtccatgaacct
aagggctactacgccaacttctgctcaggcccgtgcccatacctccgcagcgcagacact
acccacagctcagtgctgggactgtacaacaccctgaaccctgaagcctcggcctcccct
tgctgcgtaccccaggacttggagcccctgaccatcctgtactatgtcgggaggaccgcc
aaggtggagcagctctctaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001453
Entry
103001453         CDS       T03086                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta 2
  KO
K13376  transforming growth factor beta-2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04218  Cellular senescence
bacu04350  TGF-beta signaling pathway
bacu04380  Osteoclast differentiation
bacu04390  Hippo signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103001453 (TGFB2)
   04350 TGF-beta signaling pathway
    103001453 (TGFB2)
   04390 Hippo signaling pathway
    103001453 (TGFB2)
   04068 FoxO signaling pathway
    103001453 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103001453 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103001453 (TGFB2)
   04218 Cellular senescence
    103001453 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103001453 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001453 (TGFB2)
   05206 MicroRNAs in cancer
    103001453 (TGFB2)
   05205 Proteoglycans in cancer
    103001453 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103001453 (TGFB2)
   05212 Pancreatic cancer
    103001453 (TGFB2)
   05225 Hepatocellular carcinoma
    103001453 (TGFB2)
   05226 Gastric cancer
    103001453 (TGFB2)
   05220 Chronic myeloid leukemia
    103001453 (TGFB2)
   05211 Renal cell carcinoma
    103001453 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103001453 (TGFB2)
   05321 Inflammatory bowel disease
    103001453 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103001453 (TGFB2)
   05414 Dilated cardiomyopathy
    103001453 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103001453 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103001453 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103001453 (TGFB2)
   05161 Hepatitis B
    103001453 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103001453 (TGFB2)
   05144 Malaria
    103001453 (TGFB2)
   05145 Toxoplasmosis
    103001453 (TGFB2)
   05140 Leishmaniasis
    103001453 (TGFB2)
   05142 Chagas disease
    103001453 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103001453 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103001453 (TGFB2)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103001453 (TGFB2)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103001453 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 103001453
NCBI-ProteinID: XP_007173588
UniProt: A0A383ZEK2
LinkDB
Position
Un
AA seq 414 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSENAIPP
TFYRPYFRIVRFDVSAMEKNASNLVKAEFRVFRLQNPKARVPEQRIELYQILKSKDLTSP
TQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQSNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQH
SRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgcttctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcggacagatcctgagcaagctgaaactcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatttccatctacaacagcacaagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggagtactacgcc
aaggaggtttacaaaatagacatgccgcccttcttcccctcggaaaatgccatcccgccc
actttctacagaccctacttcagaatcgtccgatttgacgtctccgccatggagaagaat
gcttccaatttggtgaaggcagagttcagagtctttcgtttacagaacccgaaagccaga
gtgcctgaacaacggatcgaactgtatcagattctcaaatccaaagatttaacatctcca
acccagcgctacatcgacagcaaagtcgtgaaaaccagagcggaaggcgaatggctctcc
ttcgatgtcactgatgctgttcacgaatggctccaccataaagacaggaatctgggattt
aaaataagtttacactgtccctgctgcacctttgtaccatcgaataattacatcatcccc
aacaaaagtgaagaactagaagcgcgatttgcaggtattgatggcacctccacatatacc
agtggtgatcagaaaacaataaagtccactaggaaaaaaaacagtgggaagaccccacat
ctcctgctaatgttgttaccctcctacagacttgagtcacaacagtccaaccggcggaag
aagcgtgctttggatgcagcctattgctttagaaatgtgcaggataattgttgcctacgc
ccactttacattgatttcaagagggatcttgggtggaaatggatacatgagcctaaaggg
tacaatgccaacttctgtgctggagcgtgcccgtatctgtggagctcagacactcagcac
agtagggttctcagcttatataataccataaatccagaagcatctgcttccccttgctgc
gtgtcccaggatttagaaccactcaccattctctactacatcggcaaaacacccaagatt
gaacagctttctaatatgatcgtaaagtcttgcaaatgcagctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002687
Entry
103002687         CDS       T03086                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta 1
  KO
K13375  transforming growth factor beta-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04218  Cellular senescence
bacu04350  TGF-beta signaling pathway
bacu04380  Osteoclast differentiation
bacu04390  Hippo signaling pathway
bacu04659  Th17 cell differentiation
bacu04672  Intestinal immune network for IgA production
bacu04926  Relaxin signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05144  Malaria
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
bacu05410  Hypertrophic cardiomyopathy
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002687 (TGFB1)
   04350 TGF-beta signaling pathway
    103002687 (TGFB1)
   04390 Hippo signaling pathway
    103002687 (TGFB1)
   04068 FoxO signaling pathway
    103002687 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103002687 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103002687 (TGFB1)
   04218 Cellular senescence
    103002687 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103002687 (TGFB1)
   04672 Intestinal immune network for IgA production
    103002687 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103002687 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103002687 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002687 (TGFB1)
   05205 Proteoglycans in cancer
    103002687 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103002687 (TGFB1)
   05212 Pancreatic cancer
    103002687 (TGFB1)
   05225 Hepatocellular carcinoma
    103002687 (TGFB1)
   05226 Gastric cancer
    103002687 (TGFB1)
   05220 Chronic myeloid leukemia
    103002687 (TGFB1)
   05211 Renal cell carcinoma
    103002687 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103002687 (TGFB1)
   05321 Inflammatory bowel disease
    103002687 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    103002687 (TGFB1)
   05414 Dilated cardiomyopathy
    103002687 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103002687 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103002687 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    103002687 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103002687 (TGFB1)
   05161 Hepatitis B
    103002687 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103002687 (TGFB1)
   05144 Malaria
    103002687 (TGFB1)
   05145 Toxoplasmosis
    103002687 (TGFB1)
   05140 Leishmaniasis
    103002687 (TGFB1)
   05142 Chagas disease
    103002687 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bacu03110]
    103002687 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103002687 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103002687 (TGFB1)
Chaperones and folding catalysts [BR:bacu03110]
 Intramolecular chaperones
  Others
   103002687 (TGFB1)
Cytokines and growth factors [BR:bacu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103002687 (TGFB1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103002687 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103002687
NCBI-ProteinID: XP_007168073
UniProt: A0A383YYX6
LinkDB
Position
Un
AA seq 406 aa
MPPSGLRLLPLLLPLLWPLVLPPSRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENSNEI
YGKIKRSPHSMYMLFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNDSWR
YLSNRLLAPSDSPEWLSFDVTGVVRQWLTHGEVIEGFRLSAHCSCDSKDNTLQVDINGFS
SGRRGDLATIHGMNRPFLLLMATPLERAQHLHSPRHRRALDTNYCFRVCKGDRDGDRAGG
QPGSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYN
QHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgctgctgctgccgctgctgtggccactagtg
ctgccgcctagccggccggccgccggactgtccacctgcaagaccatcgacatggagctg
gtgaagcgaaagcgcatcgaggccatccgcggccagattctgtctaagcttcggctcgcc
agccccccgagccagggggaggtgccgcccggtccgctgcccgaggccgtactggccctt
tacaacagtacccgtgaccgggtggccggggaaagtgccgaacctgagcctgagccagag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacagcaacgaaatc
tatgggaaaatcaagcgtagcccacacagcatgtatatgctcttcaacacatcggagctc
cgggaagcggtgcccgaacctgtgttgctctctcgggcagagctgcgcctgctgaggctc
aagttaaaagtggagcagcacgtggagctgtaccagaaatacagcaatgattcctggcgc
tacctcagcaaccggctgctggcccccagcgactcaccggagtggctgtcctttgatgtc
actggagttgtgcggcagtggctgacccacggagaggtaatagagggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactccaagtggacattaacgggttcagt
tccggccgccggggtgacctcgccaccattcatggcatgaaccggcccttcctgctcctc
atggccaccccgctggagagggcccagcacctgcacagcccccggcaccgccgagccctg
gacaccaactactgcttcagggtttgcaagggagaccgagatggagaccgtgctggcggg
caaccaggctccacggaaaagaactgctgcgttcggcagctctacattgacttccgcaag
gacctgggctggaagtggattcacgaacccaagggctaccacgccaatttctgcctgggg
ccttgcccctacatctggagcctggacacgcagtacagcaaggtcctggccctgtacaac
cagcacaacccgggagcgtcggcggcgccgtgctgcgtgccgcaggcgctggagcctctg
cctatcgtgtactacgtgggccgcaagcccaaggtggagcagctgtccaacatgatcgtg
cgctcctgcaagtgcagctga

DBGET integrated database retrieval system