KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001138
Entry
103001138         CDS       T03086                                 

Gene name
DVL2
Definition
(RefSeq) dishevelled segment polarity protein 2
  KO
K02353  segment polarity protein dishevelled
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04330  Notch signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103001138 (DVL2)
   04330 Notch signaling pathway
    103001138 (DVL2)
   04390 Hippo signaling pathway
    103001138 (DVL2)
   04150 mTOR signaling pathway
    103001138 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103001138 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103001138 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001138 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103001138 (DVL2)
   05226 Gastric cancer
    103001138 (DVL2)
   05217 Basal cell carcinoma
    103001138 (DVL2)
   05224 Breast cancer
    103001138 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103001138 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    103001138 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103001138 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103001138 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 103001138
NCBI-ProteinID: XP_007166529
UniProt: A0A383YV00
LinkDB
Position
Un
AA seq 734 aa
MAGSGAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNAHLPCFNGRVVSWLVSSDNPQPETAPPAHEPRTDPAPPPPPVPPL
PPERTSGIGDSRPPSFHPNVSSSRENLEPETETESVVSLRRERPRRRDSSERGAGGHRPS
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSSSSTEQSSASRLLKRHRRRRKQ
RPPRLERASSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKG
GAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQAY
FTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIHTD
MASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYASGL
LKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGA
TPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGGAG
RTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEPGGTGDGGPPPSRGSSGGAPNLRAHP
GLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQSFH
MAMGNPSEFFVDVM
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggcgggcagcggcgccgggggcggtggtgtcggggagacgaaggtgatttaccacctg
gatgaagaagagactccctacctggtgaagatccccgtccccgccgagcgcatcaccctc
ggcgatttcaagagcgtcttgcagcggcccgcgggcgctaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagagatttcagatgacaatgctcaccttccctgc
tttaacggaagggtggtatcctggttagtgtcatcagataacccccaacctgagacggcc
cccccagcccacgagcctcggacagacccggcgcctccaccgccgcctgtaccccctctg
ccaccggagaggaccagtggcattggagactccaggcctccatccttccaccctaacgtg
tccagcagccgggaaaatctggagcccgagacagaaacagagtcagtggtgtctctgagg
cgggagcgacctcgcaggcgagacagcagtgagcgcggcgcggggggccaccggcccagc
ggcccctcgaggctggagcgccacctggcagggtacgagagctcctccaccctcatgacc
agcgagctggagagcaccagcctgggggactcggacgaggaggacaccatgagcagcagc
tccacggagcagagcagcgcctcccgcctcctcaaacgccaccggcggcggaggaaacag
cggccaccccgcctggagagggcctcatccttcagcagtgtcactgattccaccatgtct
ctcaacatcatcacagtcacgctcaacatggagaagtacaacttcctgggcatctccatc
gtgggtcagagcaacgagcggggagatggaggcatctatatcggctccatcatgaagggt
ggggctgtggcggccgacgggcgcattgagcccggggacatgcttttgcaggtgaacgac
atgaactttgagaacatgagcaacgatgatgcggtgcgggtgctgagggatatcgtgcac
aagccgggccccatcgtgctgactgtagccaagtgctgggatccctctccccaggcctat
ttcactctcccccgaaatgagcccatccagccgattgaccctgctgcctgggtctcacac
tctgctgctctgactggcaccttcccagcctatccaggctcctcgtccatgagcaccatc
acatctgggtcctctcttcctgatggctgtgagggccggggcctctccatccatacagac
atggcatctgtgaccaaggccatggcagctccagagtctggactggaagttcgggaccgc
atgtggctcaagatcaccatccctaacgcctttctgggctcggacgtcgttgactggctc
taccatcacgtagagggctttcctgagcggcgggaggcccgaaagtatgccagcgggctg
ctcaaggcaggccttatccggcacaccgtgaacaagatcaccttctctgagcagtgctat
tacgtctttggagacctcagtggcggctgtgagagttacctagtcaacctgtctctgaat
gacaacgatggctccagtggcgcttcggaccaggacaccttggctcctttgcccggggcc
actccctggcccctgctgcccaccttctcctaccagtacccagccccgcatccatacagt
ccccagcccccaccctaccacgagctctcgtcctacacctacggcggaggcagtgccagc
agccagcacagtgaggggagccggagcagtgggtcgacacgaagcgatgggggggcgggc
cgcacagggaggcctgaggagcgggcccctgagtccaagtctggcagcggcagtgagtct
gagccttccagccggggcggcagccttcggcggggcggggaacctggtgggactggtgat
gggggccctcccccatccaggggctcatcaggaggtgctcccaatctccgagcccaccca
gggctccatccctatggcccacctcctggcatggccctcccgtataaccccatgatggtg
gtcatgatgccccctcccccaccccctgtccctccagcagtgcagcctccaggggcccct
ccagtcagagacctgggctccgtgcccccagagctgacagccagccgccaaagcttccac
atggccatgggcaaccccagtgagttctttgtggatgttatgtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006135
Entry
103006135         CDS       T03086                                 

Gene name
DVL1
Definition
(RefSeq) dishevelled segment polarity protein 1
  KO
K02353  segment polarity protein dishevelled
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04330  Notch signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103006135 (DVL1)
   04330 Notch signaling pathway
    103006135 (DVL1)
   04390 Hippo signaling pathway
    103006135 (DVL1)
   04150 mTOR signaling pathway
    103006135 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103006135 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103006135 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006135 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103006135 (DVL1)
   05226 Gastric cancer
    103006135 (DVL1)
   05217 Basal cell carcinoma
    103006135 (DVL1)
   05224 Breast cancer
    103006135 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103006135 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    103006135 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103006135 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103006135 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 PDZ_2
Other DBs
NCBI-GeneID: 103006135
NCBI-ProteinID: XP_007166381
LinkDB
Position
Un
AA seq 678 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEISDDNARLPCFNGRVVSWLVLAEGTHSDAGSQGTDGHADLPPPLERTGGIGDSRPPSF
HPNVAGSRDGMDNETGTESLVSHRRERARPRNREEAARTNGHPRGDRRRDLGLPPDSAST
VLSSELESSSSGLLDSEVDNNPSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFS
SITDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPG
DMLLQVNDVNFENMARVVRRVRLRLGSSCQARVVRRVRLRLGPAFLPASVHVAEAEDAWR
GPASPGVCSAGLSSSGAGPPSHWASRAWPLRAAAGGAWGPSDPNPICQPPGLRRRPCLAE
LEEVPLTVKSDMGAVVRVMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHLAGFRE
RHLAALNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPYQYPGPPPCFPPAYQDPGFGYG
SGSAGSQQSEGSKSSGSTRSAGGSSRRALGREKESRSAGAGGSGSESDHTVPSGVGSGGW
RGGCAAGXXXXXXRSQASAAAPGLPPLHPLTKAYSVVGGPPGGPPVRELAAVPPELTGSR
QSFQKAMGNPCEFFVDIM
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctatcacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcgcccgagcgcgtcacgctggccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttcttcaagtccatggaccaggacttcggggttgtgaag
gaggagatctccgacgataatgctaggctgccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggcacacactcggatgcagggtctcagggcactgacggccacgca
gacctgcccccgcctctcgagcggacaggtggcatcggggactcccggcccccctccttc
cacccgaatgtggccggcagccgagatgggatggacaacgagaccggcacggagtccctg
gtcagccaccggcgggagcgagcccgaccccggaaccgcgaggaggccgcccggaccaac
gggcacccgaggggggaccggcggcgggacttggggctgccccccgacagcgcgtccacc
gtgctgagcagtgaacttgagtccagcagcagcggcttactagactcggaggtggacaac
aaccccagccggctgagcagctccacggagcagagcacctcctcccggctcatccggaag
cacaagcgccggcggcggaagcagcgcctgcggcagacagaccgggcctcctccttcagc
agcatcacggactccaccatgtccctgaatatcatcaccgtcacgctcaacatggagagg
caccacttcctgggcatcagcatcgtgggccagagcaacgaccggggtgacggcggcatc
tacatcggctccatcatgaagggcggcgccgtggccgccgacggccgcatcgagccgggt
gacatgctgctgcaggtgaacgacgtcaactttgagaacatggcccgcgtggtcagacgc
gtgcggctccgactgggcagcagctgccaggcccgcgtggtcagacgcgtgcggctccga
ctgggccccgccttcctcccggcctctgttcacgtggcggaggcggaagacgcctggagg
ggcccggccagcccaggggtctgttctgcggggctgtcaagcagtggggctggacccccc
agtcactgggccagcagagcctggcctctgagggctgcggcaggtggggcctggggtccg
tctgaccccaaccccatctgtcagccacccgggctgaggaggaggccgtgccttgcagag
ctggaggaagtgccgctgacggtgaagagtgacatgggcgctgtcgtccgggtcatgcag
ctgccggactcaggcctggagatccgcgaccgcatgtggctcaagatcaccatcgccaac
gccgtcatcggggcggacgtggtggactggctgtacacgcacctggcgggcttccgtgag
cggcatctcgcggccctgaacctcaacagcggctctagcggggcctcggatcaggacacg
ctggccccgctgccccacccggccgccccctggcccctggggcagggctacccctaccag
tacccggggcccccaccctgcttcccgcccgcgtatcaggaccccggcttcggctacggc
agcggcagtgctggcagtcagcagagtgaaggaagcaaaagcagtgggtccacccggagc
gctggcgggagcagccgtcgggccctggggcgcgagaaggagagccggtcggctggagct
gggggcagtggcagcgagtcggaccacacagtgcccagcggggtgggcagcggcggctgg
cgggggggctgcgcggccggtcnnnnnnnnnnnnnnnngcgcagccaggcctcggccgcc
gccccagggctccccccgctgcacccactgacaaaggcgtactcggtggtgggcgggccg
cctggggggccgcctgtccgggagctggctgctgtccccccagagctgacgggcagccgc
cagtccttccagaaggccatggggaacccctgtgagttcttcgtcgatatcatgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009589
Entry
103009589         CDS       T03086                                 

Gene name
DVL3
Definition
(RefSeq) dishevelled segment polarity protein 3
  KO
K02353  segment polarity protein dishevelled
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04330  Notch signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04916  Melanogenesis
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103009589 (DVL3)
   04330 Notch signaling pathway
    103009589 (DVL3)
   04390 Hippo signaling pathway
    103009589 (DVL3)
   04150 mTOR signaling pathway
    103009589 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103009589 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103009589 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009589 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103009589 (DVL3)
   05226 Gastric cancer
    103009589 (DVL3)
   05217 Basal cell carcinoma
    103009589 (DVL3)
   05224 Breast cancer
    103009589 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103009589 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    103009589 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103009589 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103009589 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 103009589
NCBI-ProteinID: XP_007195389
UniProt: A0A384B7Y4
LinkDB
Position
Un
AA seq 719 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPEPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHTTRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRWGFGFMEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSIT
DSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDML
LQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPA
AWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAM
ASPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRH
TVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQ
YPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKTGDSKSG
GSGSESDHTTRSSLRGARERAPSERSGPAASEHSHRSRDHHSLASSLRSHHTHPSYGPPG
VPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacctggacgggcaggagacgccgtacctggtgaag
ctgcccctgcccgccgagcgcgtcaccttggcggactttaagggcgttctgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagatc
tcggacgacaatgccaagttgccctgcttcaatggccgggtggtgtcctggctggtgtcg
gctgagggctcacacccagagccagctcccttctgtgctgacaacccatcggaactgcca
ccgcccatggagcgcacaggaggcattggggactcccggcccccttccttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagagactgactccttggtgtct
gcccagcgagagcggccacgacggagggatggcccagagcacacaacccggctgaatgga
actgcgaagggggagcggcggcgagagccaggggggtatgacagctcatccacccttatg
agcagcgagttggagaccaccagcttctttgattcagatgaggatgactccaccagcagg
tggggctttggtttcatggagcagagcagcgcctcacgcctgatgagaagacacaagcgg
cggcggcggaagcagaaggtttcgcggattgagaggtcctcgtccttcagcagcatcacg
gactccaccatgtcactcaacatcatcacggtcactctcaacatggaaaagtataacttc
ttgggtatctccattgtgggccaaagcaacgagcgtggtgacggaggcatctacattggc
tctatcatgaaggggggggccgtggctgctgatggacgcatcgagccaggagatatgctg
ttacaggtaaacgagatcaactttgagaacatgagtaatgacgacgcggtccgggtactg
cgggagattgtgcacaaaccagggcccatcaccttgactgtagccaagtgctgggaccca
agtccacgtgggtgcttcacactgcccaggagcgagcccatccggcccattgaccccgcg
gcctgggtctcccacactgcagccatgaccggcaccttccctgcctacggcatgagcccc
tccctgagcaccatcacctccaccagctcctccatcaccagctccatccctgacacagag
cgcctagacgacttccacctgtccatccacagtgacatggccgccatcgtaaaagccatg
gcctcccctgaatccgggctggaggtccgtgacaggatgtggctcaagattaccatcccc
aacgctttcatcggctcggacgtggtggactggctgtaccacaacgtggaaggcttcact
gaccggcgagaggcccgcaaatacgccagcaacctgctgaaggccggcttcatccgccac
actgtcaacaagatcaccttctctgagcagtgctactacatcttcggcgacctctgtggc
aacatggccaacctctccctccacgatcatgatggctccagcggcgcctccgaccaggac
acgctggcccctctgccgcacccaggggctgccccttggcccatggctttcccttaccag
tacccgccgcccccacacccctacaacccgcacccaggcttccccgagctggggtacagc
tatggcgggggcagcgccagcagtcagcacagtgaaggcagccggagcagtggctccaac
cgtagcggcagcgaccggcggaaggagaaggacccgaagaccggggactcgaagtcgggc
ggcagcggcagcgagtcggaccacacgacccgcagcagcctgcggggggcgcgggagcgg
gcgccgagcgagcgctcgggtcctgccgccagcgagcacagccaccgcagccgcgaccac
cactcgctggccagcagcctgcgcagccatcacacgcacccgagctacggcccccccggg
gtgccccctctctacggcccccccatgctgatgatgcccccaccgcctgcggccatgggg
cccccgggagcccctccgggccgcgacctggcctccgtgccccctgaactgaccgccagc
agacagtccttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

DBGET integrated database retrieval system