KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001145
Entry
103001145         CDS       T03086                                 

Definition
(RefSeq) whey acidic protein-like
  KO
K17106  whey acidic protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    103001145
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 103001145
NCBI-ProteinID: XP_007187842
UniProt: A0A384AKF2
LinkDB
Position
Un
AA seq 171 aa
MRCLASLALTLLALKAALALAPALTLPGQAVCPELSSSSEDSCTISCVNDENCPQGTKCC
ARSPCSRSCVVPLIVPVPKAGRCPRVQAPPAPKLCLERNECSRDDQCMENQKCCFSSCAM
RCMVPTTGSPQVPEGSKTQERAGAQAAVTQGCNSCRPLQALDAVGLEWVSD
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcgctgtcttgccagcctggccctgaccctgctcgccctgaaggctgccctcgcgctg
gccccggccctcaccttgccagggcaggccgtgtgcccagagctcagctcctcctccgag
gattcctgcacaatctcctgtgtcaacgatgagaactgtccccaaggcaccaagtgctgc
gcccggagcccctgcagccgatcctgtgtggtgcccctcatcgtgcctgttccaaaggct
ggccgctgtccccgggtgcaggccccgccggcccctaagctctgcttagagagaaacgag
tgctccagggatgaccaatgtatggagaaccagaagtgctgcttcagctcgtgtgccatg
aggtgtatggtccccaccacagggtctccgcaggtccctgagggcagtaagacacaggag
agggcgggggctcaggcagcagtgacccagggctgcaacagctgcaggcctctgcaggca
cttgatgccgttgggttagagtgggtctcagactag

DBGET integrated database retrieval system