KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001169
Entry
103001169         CDS       T03086                                 

Gene name
APC
Definition
(RefSeq) APC, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04810  Regulation of actin cytoskeleton
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103001169 (APC)
   04390 Hippo signaling pathway
    103001169 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103001169 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103001169 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001169 (APC)
   05206 MicroRNAs in cancer
    103001169 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103001169 (APC)
   05225 Hepatocellular carcinoma
    103001169 (APC)
   05226 Gastric cancer
    103001169 (APC)
   05217 Basal cell carcinoma
    103001169 (APC)
   05213 Endometrial cancer
    103001169 (APC)
   05224 Breast cancer
    103001169 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103001169 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    103001169 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103001169 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103001169 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103001169 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103001169 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103001169 (APC)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103001169 (APC)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103001169 (APC)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     103001169 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_u15 APC_rep APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 103001169
NCBI-ProteinID: XP_007192165
UniProt: A0A384AXK8
LinkDB
Position
Un
AA seq 2865 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRITRIQQIEKDILRIRQLLQSQAT
EAERSSQSKHEAGSHEAERQNESQGVAEINMATSGSGQGSTARIDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGRKATRGISSQ
ELGQGLSGGLQAIAELLQVDCEMYGLTTDHYSITLRRYAGMALTNLTFGDVANKATLCSM
KGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKE
STLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNV
SSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMG
AVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEA
ELDAQHLSETFDNIDNLSPKASHRSKQRHKQNLYGDYVFDTNRHDDNRSDNFNTGNMTVL
SPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGISLVNYHPATETPGTSSKRGLQIST
TAAQIAKVMEEVSTIHTSQEDRSSGSTPELHCGTDERNALRRSSTAHTHANSYNFPKSEN
SNRTCPVPYAKVEYKRSSNDSLNSVSSSDGYGKRGQMKPSAESYSEDDESKFCSYGQYPA
DLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQ
NEQRQSRSQSTTYPVYPESTDDKHLKFQPHFGQQECVSPYRSRAANGSETNRVGSNHGIN
QNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLK
YTTDIPSSQKPAFSFSKNSSGQSTKTEHISSSSENTSTPSSNAKRQNQLHPSSAQSRSGQ
TQKATSSSCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDQTTQEADSAN
TLQIAEIKENSGTRSTEDSVSEVPTVSQHIRNKSSRLQASGLSSESTRHKAVEFSSGAKS
PSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISP
SDLPDSPGQTMPPSRSKTPPPPPPQTAQTKQEVPKNKAPSAEKRESGPKQAAVNAAVQRV
QVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETEN
EQPEESNENQEKEAEKPTDSEKDLLDDSDDDDIEILEECIISAMPTKSSHKAKKPAQTSS
KLPPPVARKPSQLPVYKLLPSQNRLQAQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSD
LTIESPPNELAAGEGVRAGTQSGEFEKRDTIPTEGRSTDEAQTGKASSVTIPELDDNKTE
EGDILAECINSAMPKGKSHKPFRVKKIMDQVQQASMSSSGTNKNQLDGKKKKPTSPVKPI
PQNTEYRTRVRKNTDSKNNLNAERNFSDNKDSKKQNLKNSSKDFNDKVPNNEDRVRGSFT
FDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKGKENKESESKVTNHTE
LTSNQQSASKTQTVQKHPINRGQPKPVLQKQSTFPQSSKDIPDRGAATDEKLQNFAIENT
PVCFSQNSSLSSLSDIDQENNNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTP
VCFSRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKANNEKHSPRNMGGMLAEDLTL
DLKDIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSL
KSGISLGSPFHLTPDQEEKPFASNKGPRILKPGEKSTLETKKLESENKGIKGGKKVYKSL
ITGKVRSNLEVSSQMKQPLQTNMPSISRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPAS
KSPSEGQAATTSPRGAKPSVKSELSPVTRQASQTPGSNKGPSRSGSRDSTPSRPAQQPLS
RPMQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNL
TKQTGLSKNVSSIPRSESASKGLNQMSTSNGANKKVELSRMSSTKSSGSESDRSERPVLV
RQSTFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPILSPSLPDMSLSTHSS
VQAGGWRKLPPNLSPTIEYNDGRPVKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSL
PRVSTWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQTKENQVSTKGTWRKIKES
EISPTSSTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGN
TPPVIDTVSEKGNPNTKDSKDNQGKQNVSNGSAPVRTMGLENRLNSFIQVDAPDQKGTEA
KPGQSNPVPASETNESSIAERTPFSSSSSSKHSSPSGTVAARVSPFNYNPSPRKSSADST
SARPSQIPTPVNNNTKKRDSKTDNTESSGTQSPKRHSGSYLVTSV
NT seq 8598 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagctatg
gcttcgtctggacagattgatttattagagcgtctcaaagaacttaacttagatagcagt
aatttccctggagtgaaactacggtcaaaaatgtccctccgttcttacggaagccgagaa
ggatctgtatctagtcgttcaggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaatggaagcagagaaaataccggttatttagaagaacttgaaaaagag
agatcattgcttcttgctgaccttgacaaagaagaaaaggaaaaagactggtattatgct
caacttcagaatctcactaaaagaatagatagtcttcctttaactgaaaatttttcctta
caaacagatatgaccagaaggcaattggaatatgaagcaaggcaaatcagagttgcaatg
gaagaacaactgggtacttgccaggatatggaaaaacgagcacagcgaagaataaccaga
attcaacaaatagagaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagaggtcatctcagagcaagcatgaagccggctcacatgaagctgagcgacag
aatgaaagtcaaggagtggcagaaatcaacatggcaacttcgggtagtggtcagggttca
actgcacgaatagatcacgaaacagccagtgttttgagttctagcagcacacattctgct
cctcgaaggctgacaagtcatctgggaaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcactccacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcaaatctgtcctgctgtgtgtgttctaatgaaactttcgtttgatgag
gagcatagacacgcaatgaatgaacttggtaggaaggctacccggggcatttcatcacag
gagctagggcaggggctttcagggggactacaggccattgcagaattattgcaagtggac
tgtgaaatgtatggacttactactgaccactacagtattaccttaagacgatatgcagga
atggctttgacaaacttgactttcggagatgtagccaacaaggctacactatgctctatg
aaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaggacttacagcag
gttattgcaagtgttttgagaaatctgtcttggagagcagatgtaaatagtaaaaagact
ttgcgtgaagttggaagtgtgaaagcattgatggaatgtgctttggaagtgaaaaaggaa
tcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacactgcactgagaat
aaagctgatatatgtgccgtagatggtgcgcttgcatttttggttggcactctcacttac
cggagccagacaaatactttagctattattgaaagtggaggtgggatattaaggaatgtg
tccagcttgatagctacgaatgaggaccacaggcaaatcctaagagagaataattgctta
caaaccttattacaacacttgaaatctcacagtttgacaatagtcagtaatgcatgcgga
accttgtggaatctctcagcaagaaatcctaaagatcaggaagcattatgggacatggga
gcagtcagcatgctcaagaacctcattcattcaaagcacaagatgattgctatgggaagt
gctgcagctttaaggaatctcatggcaaatagacctgcaaagtataaggatgccaatatc
atgtctcctggttcaagcttgccttctcttcatgtcaggaaacaaaaagccctagaagca
gaattagatgctcagcatttatcagaaacttttgacaatattgacaatttaagtcccaag
gcatctcatcgtagtaagcagagacacaagcaaaatctctatggtgactatgtttttgac
accaatcgacatgacgataataggtcagacaattttaatactggaaacatgactgtcctg
tcaccatatttaaatactacagtgttgcccagctcctcttcatcaaggggaagtttagat
agttctcgttctgagaaagatagaagtttggagagagaacgaggtattagcctagtcaac
taccacccagcaacagaaactccaggaacctcttcaaagcgaggtttgcagatttctacc
actgcagcccagattgccaaagtcatggaagaagtatcaaccattcatacctcccaggaa
gacagaagttctgggtctaccccagaactacactgtgggacagatgagaggaatgcacta
agaagaagctctaccgcccacacacatgcaaactcttacaacttccccaagtcagaaaac
tcaaacaggacatgtccagtgccatatgccaaagtagaatacaagagatcttcaaatgat
agtttaaatagtgtcagcagtagtgatggttatggtaaaagaggtcaaatgaaaccttca
gctgaatcctattctgaagatgatgaaagtaaattttgcagctatggtcagtatccagct
gacctagcccataaaatacatagtgcaaatcatatggatgataatgatggagaactagat
acaccaataaattatagtcttaaatattctgatgaacagttgaactccggaaggcaaagt
ccttcacagaatgaaagatgggcaagacccaaacatataatagaagatgaaataaaacaa
aatgagcaaagacaatcaaggagtcaaagcacaacttatcctgtatatcctgagagcact
gatgataaacacctcaagttccaaccacattttggacagcaagaatgtgtttccccatat
aggtcaagagcagccaatggttcagaaacaaatcgagtaggttctaatcatggaattaat
caaaatgtaaatcagtctttgtgtcaggaagatgactatgaagatgataagccaaccaac
tatagtgaacgttactctgaggaagagcaacatgaggaagaagagagaccaaccaattat
agcataaaatataatgaagaaaaacatcatgtggatcagcctattgattatagtttaaaa
tataccacagacattccttcttcacagaaaccagcattttcattctcaaagaattcatct
ggacaaagcactaaaactgaacacatctcttcaagcagtgagaatacatccacaccttca
tctaatgccaagaggcagaatcagctccatccaagttcagcacagagcagaagcggtcag
acccaaaaagccacctcttcctcttgcaaagttccctctatcaaccaagaaacaatacag
acttactgtgtagaagataccccaatatgtttttcaagatgtagttcattatcatctttg
tcatcagctgaagatgaaatagggtgtgatcagacaacacaagaagcagattctgctaat
accctacaaatagcagaaataaaagaaaacagtggaactagatcaactgaagattctgtg
agtgaagttccaacagtatcacagcacattagaaacaaatccagcagactccaggcttct
ggtttatcttcagaatctaccaggcacaaagctgttgaattttcttcaggggccaaatct
ccatcaaagagtggtgctcagacacctaaaagtccaccagagcactacgttcaggagact
cctctcatgtttagcagatgtacttctgtcagttcacttgatagttttgagagtcgttcg
attgccagctccgttcagagtgaaccctgcagtggaatggtgagtggcattataagcccc
agtgaccttccagatagccctggacaaaccatgccaccaagcagaagtaaaacccctcct
ccccctcctcctcaaacagctcagactaagcaagaagtacctaaaaataaagcacctagt
gctgagaagagagaaagtggccctaagcaagctgctgtaaatgctgcagtacagagggtc
caggttcttccagatgctgatactttgttacattttgccacagaaagtactcctgatgga
ttttcttgttcatctagcctgagtgctctgagcctcgatgagccatttattcagaaagat
gtggaattaagaataatgcctccagttcaggaaaatgacaatgggaatgaaacagaaaat
gagcagcctgaagaatcaaatgaaaaccaggaaaaagaggcagaaaaacccactgattct
gaaaaagatctattagatgattcagatgatgacgatattgaaatactagaagagtgtatt
atttctgccatgccaacaaaatcttcacacaaagccaaaaagccagcccagacttcttcc
aaattacctccacctgtggcaaggaaaccaagtcaactgcctgtttacaaacttctgcca
tcacaaaacagattacaagcacaaaagcatgttagttttacaccaggagatgatatgcct
cgggtgtattgtgtagaagggacacctataaacttttccacagctacatctctaagtgat
ctaacaatagaatcccctccaaatgagttagctgctggagaaggtgttagagcaggaaca
cagtcaggtgaatttgaaaaacgagacaccattcctacagaaggcagaagtacagatgag
gctcaaacagggaaagcctcatctgtaactatacctgaactggatgacaataaaacagaa
gaaggcgatattcttgcagaatgcattaattctgctatgcccaaaggaaaaagtcacaag
cctttccgtgtgaaaaagataatggaccaggtccaacaagcatctatgtcttcatctgga
actaacaaaaatcaattagatggtaagaaaaagaaacctacttcaccagtaaaacctata
ccacaaaatactgaatacaggacacgtgtaagaaaaaatacagactcaaaaaataattta
aatgctgaaagaaatttctcagacaacaaagattcaaagaaacagaacttgaaaaatagt
tccaaggacttcaatgataaggtcccaaataatgaagatcgagtcagaggaagttttact
tttgattcacctcatcattacacacctattgaaggcactccatactgtttttcacgaaat
gattctttgagttctctagattttgatgatgatgatgtcgacctttccagggaaaaggct
gaattaagaaaggggaaggaaaataaggaatcagaatctaaagttaccaaccacacagaa
ctaacctcaaaccaacaatcagctagtaagacacaaactgttcaaaaacatccaataaat
cgaggtcagcctaaacccgtgctgcagaagcaatccacttttccccagtcctccaaagat
ataccagacagaggggcagcaacagatgagaaattacagaattttgctattgaaaatact
ccggtttgcttttcccaaaattcctctctaagttctcttagtgacattgatcaagaaaac
aacaacaacaaggaaaatgaacctatcaaagagacagagccccctgactcacagggagaa
ccaagtaaacctcaggcgtcaggttatgctcctaaatcatttcacgttgaagatacccct
gtttgtttctcaagaaacagttctctcagttctctcagtattgattctgaagatgacctg
ttgcaggaatgtataagttctgcaatgccaaaaaagaaaaagccttcaagactcaaggct
aataatgaaaagcatagtcccagaaatatgggtggcatgttagcagaagatttgacactc
gatttgaaagatatacagagaccagattcagaacatggtttatcccctgattcagaaaat
ttcgattggaaagctattcaggaaggtgcaaattccatagtaagtagtttacatcaagct
gctgctgccgcatgtttatctagacaagcttcgtctgattcagattccatcctttccctg
aaatcaggaatctctctgggatcaccatttcatcttacacctgatcaagaggaaaaaccc
tttgcaagtaataaaggcccacgaattctaaaacctggggagaaaagtacattggaaact
aagaagttagaatctgaaaataaaggaataaaaggagggaaaaaagtatataaaagtttg
attactggaaaagttcgatctaatttggaagtttcaagccaaatgaaacaaccccttcaa
acaaacatgccttcaatctctcgaggtaggacaatgattcacattccaggagttcggaat
agctcttcaagtacaagtccagtttctaaaaaaggcccaccccttaagactccagcctcc
aaaagccctagtgaaggtcaggcagctaccacttcccccagaggagccaagccatcagtg
aagtcagaattaagccccgttacgaggcaggcatcccagacacctgggtcaaataaaggg
ccttctagatcaggatctagagattccactccgtcaagacctgcccagcagccattaagt
agacctatgcagtctccagggcgaaactcaatttctcctggtagaaatggaataagtcct
cctaacaaattatctcagctgccaaggacgtcatcccctagtactgcttcaactaagtcc
tcgggttctgggaaaatgtcttacacgtctcctggcagacagatgagccaacagaacctc
accaaacaaacgggtttatccaagaatgtcagtagtatcccaagaagtgaatctgcctcc
aaaggactaaatcaaatgagtactagcaatggagccaataaaaaggtagaactttctaga
atgtcttcaactaaatcaagtggaagtgaatctgataggtcagagagacctgtattagta
cgccagtcaactttcatcaaagaagctccaagcccaaccctaaggagaaaattggaggaa
tctgcttcatttgaatctctttctccatcttctagaccagattctcccactaggtcccag
gcacagactccaattttaagtccttcccttcctgatatgtctctgtctacacattcgtct
gttcaggctggtggatggcgaaaactcccacctaatctcagtcccaccatagagtataat
gatggaagaccagtaaagcgccatgatatagcacgctctcattccgaaagtccttccaga
cttcccatcaataggtcaggaacctggaaacgtgagcacagcaaacactcatcatccctt
ccccgagtaagcacttggaggagaaccggaagttcatcctcaattctttccgcttcatca
gaatctagtgaaaaagcaaaaagtgaggatgaaaaacatgtgaactctatttcaggaacc
aaacaaactaaagaaaaccaagtatccacaaaaggaacatggagaaaaataaaagaaagt
gaaatttctcccaccagtagtacttctcagaccacttcctcaggtgctgcaaacggtgct
gaatcaaagactctgatttatcaaatggcacctgctgtttctaaaacagaggatgtttgg
gtgagaattgaggactgtcccattaacaaccctagatctggaagatctccaacaggaaat
actcccccagtgattgacaccgtttcagaaaagggaaacccaaacactaaagattcaaaa
gataatcagggaaaacaaaatgtgagcaatggtagtgctcctgtacgcaccatgggtttg
gaaaaccgcctgaactcctttattcaggtagatgccccagaccaaaaaggaactgaggca
aaaccgggacaaagtaatcctgtccctgcatcagagactaatgaaagttctatagctgaa
cgtaccccatttagttctagcagctcaagcaagcacagttcaccgagtgggactgttgct
gccagagtgagtccttttaattacaacccaagcccaaggaaaagcagcgcagatagcact
tcagcccgaccatctcagatcccaacaccagtgaataacaacacaaagaaacgagattca
aaaactgacaatacagaatccagtggaactcaaagtcctaaacgccattctgggtcctac
ctggtgacatctgtttaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014178
Entry
103014178         CDS       T03086                                 

Gene name
APC2
Definition
(RefSeq) APC2, WNT signaling pathway regulator
  KO
K02085  adenomatosis polyposis coli protein
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04310  Wnt signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04810  Regulation of actin cytoskeleton
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05213  Endometrial cancer
bacu05217  Basal cell carcinoma
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103014178 (APC2)
   04390 Hippo signaling pathway
    103014178 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103014178 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103014178 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014178 (APC2)
   05206 MicroRNAs in cancer
    103014178 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103014178 (APC2)
   05225 Hepatocellular carcinoma
    103014178 (APC2)
   05226 Gastric cancer
    103014178 (APC2)
   05217 Basal cell carcinoma
    103014178 (APC2)
   05213 Endometrial cancer
    103014178 (APC2)
   05224 Breast cancer
    103014178 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103014178 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    103014178 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103014178 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103014178 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103014178 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bacu03036]
    103014178 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103014178 (APC2)
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103014178 (APC2)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103014178 (APC2)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     103014178 (APC2)
SSDB
Motif
Pfam: APC_rep APC_basic APC_N_CC Arm Suppressor_APC APC_r Arm_APC_u3 SAMP bZIP_1 APG6_N HALZ IL4
Other DBs
NCBI-GeneID: 103014178
NCBI-ProteinID: XP_007198596
UniProt: A0A384BFV4
LinkDB
Position
Un
AA seq 1582 aa
MTSSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQE
ARVLVSSGQTEVLEQLKALQVDITSLYNLKFQPPALAPEPTARTPEGSPVHSSGPSKDSF
GELSRATIQLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETQFSLQM
DLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDKELLSAQDRVQQTEPQI
LLGXGHRTPIRLEGVQVGPGEPGGAPHPDISCPSQVEVVFWLLSMLATRDQEDTARTLLA
MSSSPESCVAMRRSGCLPLLLQILHGTEAGAGGRNGTPGAPGAKDARMRANAALHNIVFS
QPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDGGPEGGGAGGAPVPIEPQICQATCA
VMKLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGD
VANKAALCARRGCMEAIVAQLASESEELHQVVSSILRNLSWRADISSKKVLREVGSMTAL
MQCVLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAII
ESGGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSA
GDQELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQAAATAVSPGACAPS
LYVRKQRALEAALDARHLAQALDHLEKQGLPEAEAASKKPLPPLRHLDGLAQDYASDSGC
FDDDDAPSLATAAAATAEPDGHCPREHLRPYPLAALAEHCEGPLCGQARPSRLDLNLPSG
QVEPKARDAVATDARVCTIKLSPTYQHVPLLEGTARVGAGSLAPRARKQAWLPAEDLNKV
PEKLAAEKAPLCLSRCSSLSSLSSAGRPGPSEAGDLDDSDSSLEGLEEAGPSEAGLDGAW
QGPGAASLPMAIPVPQRGRGLGVEDATPSSSSENCVQETPLVLSRCSSVSSLGSFESPSI
ASSVASDPCSGLGSGTVSPSELPDSPGQTXADYPTRPSNPSPTAPAPPGEREATQFSLQW
ESYVKRFLDIADCRERCRLPSELDAGSVRFTVEKPDENFSCASSLSALALHELYVQKDVE
LRLLPPACPERSSGGGVGPXGTAXXXXXXXLELLRECLGGAVPARLRKVASALVPGRRTL
PVPVYMLVPAPAREDESCTDSAEGTPVTFSSATSLSEETLQGPPGDGGPAQGQKAAGRAA
PTRQRAEAELLRRCTGSGVPRRRPQVSGPGCRQSRAAQQEKRPAEGPREHSEEAAGSDHA
SDLDSVEWRAIQEGANSIVTWLHQAAAAATREASSESDSVLSFASGQSVGSTLQPPLHRK
GRRPRAEGQAGSAMRPEKRDRALAQRSGDLEKPRGAQKATSGVPAVLRGRTVIYMPSPAT
RAQPKGAPGPRNVPRKTGAPNPVQPAAPAKTPGPGQQRSRSLHRPGKISELAALSPPQRS
ATPPARLAKTPSSSSSQTSPASQPLTRRSPPAVPAAGPLRHGSPSRSARVPPFNYVPSPM
VAATTDSAVEKAPAPVPTDLLG
NT seq 4749 nt   +upstreamnt  +downstreamnt
atgacgagctccgtggcgccctacgaacagctggtgcggcaggtggaggccttgaaggcc
gagaacagtcacctgaggcaggagcttcgggataactcaagccacttgtccaagctggag
acagaaacgtcaggcatgaaggaggtcctgaagcacttgcagggcaagctggagcaggag
gcccgcgtgctggtgtcctcagggcagaccgaggtgctggagcagctgaaagccctgcag
gtggacatcaccagcctgtacaacctcaagttccaacccccggctctggcccccgagccc
actgcccggacccccgagggaagcccggtgcacagctccgggccctccaaggacagcttt
ggggagctgagccgggccaccatccagctgctggaggaactggaccgggaacggtgtttc
ctgttgaatgagattgagaaggaggagaaggagaagctctggtattactcgcagctgcag
ggcctatccaagcgcctggacgaactccctcacgtggagacgcagttctccctgcagatg
gatctgatccggcagcagctggagttcgaagcccagcacatccgctcgctgatggaggag
cgctttggcacctcggacgagatggtgcagcgggcacagatccgtgcttcccgcctggag
cagatcgacaaggagctgctgtcggcgcaggaccgggtgcaacagaccgagccccagatt
ctcctgggctgaggtcataggacccccatccgtttagagggagtgcaggtggggccaggt
gagccaggcggggctccccaccctgacatctcctgcccctcgcaggtggaggtggttttc
tggctgctgtccatgctggcgacgcgtgaccaggaggacacggcacggacgctgctcgcc
atgtccagctcacctgagagctgcgtggccatgcgccgctcgggctgcctgccgctgctg
ctgcagatcctgcatggcactgaggccggggctgggggtcgcaacgggaccccaggggcg
ccgggagccaaggatgcgcgcatgcgcgccaacgcagcgctgcacaacatcgtcttctcc
cagccggaccagggtctggcgcgcaaggaaatgcgcgtcctgcacgtgctcgagcagatc
cgtgcctactgtgagacctgctgggactggctgcaggcccgggacggcgggcccgagggc
ggtggcgccggcggcgccccggtccccatcgagccacagatctgccaggccacctgcgcc
gtgatgaagctgtccttcgacgaggaataccgccgcgccatgaacgagctgggtgggctg
caggctgtggcggagttactgcaggtcgactatgagatgcacaagatgacccgggaccct
ctcaacctggccctgcgccgatacgccggcatgaccctcaccaacctaaccttcggggac
gtcgccaacaaggccgcactgtgcgcccgccggggctgcatggaggccattgtggcgcag
ctggcgtccgagagtgaggagctgcaccaggtggtgtccagcatcctgcgcaacctgtcc
tggagggcggacatcagcagcaagaaggtgctgagggaggtgggcagcatgacggccctg
atgcagtgcgtcctgcgagcctccaaggagtccaccctgaagagcgtgctcagcgccctg
tggaacctctcggcgcacagcacggagaacaaggccgccatctgccaggtggacggcgcc
ctgggcttcctggtcagcacactgacctacaagtgccagagcaactcgctggccatcatc
gagagcggcggcggcatcctgcgcaacgtgtccagcctcatcgccacccgcgaggactac
aggcaggtgctgcgggaccacaactgcctgcagacgctgctgcagcacctgacgtcgcac
agcctgaccatcgtgagcaacgcatgcggcacgctctggaacctgtcggcccgcagcgcc
ggcgaccaggagctgctgtgggacctgggcgccgtgggcatgctgcgcaacctggtgcac
tccaagcacaagatgatcgccatgggcagcgccgccgccctgcgcaacctgctggcccac
cggcccgccaagtaccaggcggcggccaccgccgtctcccccggcgcctgtgcgcccagc
ctgtacgtgcgcaagcagcgggcgctggaggctgcgctggatgcgcggcacctggcgcag
gcgctcgaccacctggagaagcagggcctgcctgaggctgaggccgcctccaagaagccg
ttgccgcccctgcgccacctggacggcctggcccaggactacgcttctgactcgggctgc
ttcgatgatgacgacgcaccctccctggccaccgctgctgccgccaccgccgagcccgac
gggcactgtccccgtgagcacttgcggccctacccgctggccgcgctggccgagcattgc
gagggacccctgtgcggccaggcgcggcccagccggcttgacctcaacctgcccagcggc
caggttgagcccaaggcccgggacgccgtggccacagatgcccgcgtgtgcaccatcaag
ctgtcgcccacctaccagcacgtgccgctgcttgagggcaccgccagggtgggcgcaggg
tccctggcccccagggcccggaaacaggcctggctgcccgcagaggacctgaacaaggtg
cccgagaagctggcggcagagaaggcacccctctgcctgtcgcgctgcagctccctgtcc
tcactgtcctcggccggccgcccagggcccagtgaggccggggacctggacgacagcgac
tcgtccctggaggggctggaggaggccggccccagtgaggccgggctggacggggcctgg
caggggccgggggccgcctccctgcccatggccatcccggtgcctcagcggggccggggc
ctgggggtggaggacgccacgccgtccagctcgtccgagaactgcgtgcaggagacgcca
ctggtgctgagccgctgcagctcggtcagctcgctgggcagcttcgagagcccatccatc
gccagctccgtcgccagcgacccgtgcagcgggctgggcagcggcacagtcagccccagc
gagcttcctgacagccccgggcagacnnnngcagactaccccacaaggcccagcaacccc
tccccgacggcccccgcgccgccgggcgagcgtgaggccacccagttcagcctgcagtgg
gagagctacgtgaagcgcttcctggacatcgccgactgccgggagcgctgccggctgccg
tccgagctggacgcgggcagcgtgcgcttcactgtggagaagcccgacgagaacttctca
tgtgcttccagcctgagtgcgctggctctgcacgagctctacgtgcagaaggacgtggag
ctgcggttgctgcccccggcctgccccgagcgcagcagtgggggaggcgtgggccccnng
ggcaccgccnnnnnnnnnnnnnnnnnnnncctggagctgctgcgcgagtgcctgggtggg
gccgtgcccgcccggctccgcaaggtggcctcggcactggtgcctggccgccgcaccctg
cctgtgcccgtctacatgctggtgcctgccccagcccgggaggatgagtcctgcactgac
tcggccgagggtacgccagtcaccttctccagcgccacctccctcagcgaggaaacactg
cagggaccccccggggacggcgggcctgcgcaggggcagaaggctgcaggccgtgccgcc
cccaccaggcagcgggccgaggcagagctgctccggcgctgcactggctcaggcgtgccc
agacgccggccccaggtgtctggcccagggtgccgccagtcccgagcggcgcagcaggag
aagaggccagcagaggggccccgggagcacagtgaggaggcggcgggctcggaccacgcc
tcagacctggacagcgtcgagtggcgcgccatccaggagggggccaactccatcgtcacg
tggctacaccaggcagcggcggcggccacccgcgaggcctcctctgagtccgactccgtt
ctgtcctttgcctcagggcagtcggtgggctccaccctgcagcctcccctgcacaggaag
gggcgacggccaagggcagagggccaggcgggcagtgccatgcggccagagaaacgggac
agggctctggcccagcgcagcggcgacctggagaagccacgtggcgctcagaaggccacg
tctggggtgccagccgtgctccggggacgtacggtgatctacatgcccagcccagcgacc
cgggcccagcccaaaggtgcccctgggccccgcaatgtgccgagaaagacaggagcccca
aacccagtgcagccagcagcccccgccaaaaccccaggccccgggcagcagcggtctcga
agcctgcaccgacctggcaagatctcagagctggcggcgctgagcccccctcagaggagc
gccacgccacctgcccgcctcgccaagaccccctcgtcgagctcctcccagacctccccg
gcctcccagcctctgacgaggaggtcacccccggccgtcccggctgcaggccccctccga
cacggctcccctagccgctctgcccgcgtcccccccttcaactacgtgcccagccccatg
gtggcagccaccactgactctgccgtggagaaagcccccgcccccgtccctaccgacctc
ctgggatag

DBGET integrated database retrieval system