KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001311
Entry
103001311         CDS       T03086                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04024  cAMP signaling pathway
bacu04137  Mitophagy - animal
bacu04210  Apoptosis
bacu04310  Wnt signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04530  Tight junction
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05224  Breast cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103001311
   04012 ErbB signaling pathway
    103001311
   04310 Wnt signaling pathway
    103001311
   04668 TNF signaling pathway
    103001311
   04024 cAMP signaling pathway
    103001311
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103001311
  09143 Cell growth and death
   04210 Apoptosis
    103001311
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103001311
   04530 Tight junction
    103001311
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103001311
   04621 NOD-like receptor signaling pathway
    103001311
   04625 C-type lectin receptor signaling pathway
    103001311
   04660 T cell receptor signaling pathway
    103001311
   04658 Th1 and Th2 cell differentiation
    103001311
   04659 Th17 cell differentiation
    103001311
   04657 IL-17 signaling pathway
    103001311
   04662 B cell receptor signaling pathway
    103001311
  09152 Endocrine system
   04912 GnRH signaling pathway
    103001311
   04915 Estrogen signaling pathway
    103001311
   04921 Oxytocin signaling pathway
    103001311
   04926 Relaxin signaling pathway
    103001311
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103001311
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103001311
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001311
   05203 Viral carcinogenesis
    103001311
   05231 Choline metabolism in cancer
    103001311
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103001311
  09162 Cancer: specific types
   05210 Colorectal cancer
    103001311
   05211 Renal cell carcinoma
    103001311
   05224 Breast cancer
    103001311
  09163 Immune disease
   05323 Rheumatoid arthritis
    103001311
   05321 Inflammatory bowel disease
    103001311
  09165 Substance dependence
   05030 Cocaine addiction
    103001311
   05031 Amphetamine addiction
    103001311
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103001311
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103001311
   04933 AGE-RAGE signaling pathway in diabetic complications
    103001311
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103001311
   05135 Yersinia infection
    103001311
   05133 Pertussis
    103001311
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103001311
   05170 Human immunodeficiency virus 1 infection
    103001311
   05161 Hepatitis B
    103001311
   05171 Coronavirus disease - COVID-19
    103001311
   05162 Measles
    103001311
   05167 Kaposi sarcoma-associated herpesvirus infection
    103001311
   05169 Epstein-Barr virus infection
    103001311
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103001311
   05142 Chagas disease
    103001311
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103001311
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103001311
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    103001311
SSDB
Motif
Pfam: Jun
Other DBs
NCBI-GeneID: 103001311
NCBI-ProteinID: XP_007164811
UniProt: A0A383YPZ9
LinkDB
Position
Un
AA seq 199 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGLVAPAVASVAGLLGAETVRQTVNLPMSATRKVERIFPIE
HPQHFIQTSVIALIKVSPS
NT seq 600 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggcgcctacggctacagtaaccccaagatcctgaagcagagcatgaccctg
aacctggccgaccccgtgggcagcctgaagccgcacctccgggccaagaactccgatctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgtccc
aagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtctgcggcgcagccggtcagcggggcg
ggcctggtggctccagccgtggcctcggtggcgggattactgggagcagagacagttcgc
caaacagtgaatttgcccatgtcagcaacccggaaggtggaacgaatattcccaattgag
catccacagcattttatccaaacttctgtgatagcacttatcaaagtatcaccatcgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014668
Entry
103014668         CDS       T03086                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04024  cAMP signaling pathway
bacu04137  Mitophagy - animal
bacu04210  Apoptosis
bacu04310  Wnt signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04530  Tight junction
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05132  Salmonella infection
bacu05133  Pertussis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05161  Hepatitis B
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05224  Breast cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05321  Inflammatory bowel disease
bacu05323  Rheumatoid arthritis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103014668
   04012 ErbB signaling pathway
    103014668
   04310 Wnt signaling pathway
    103014668
   04668 TNF signaling pathway
    103014668
   04024 cAMP signaling pathway
    103014668
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103014668
  09143 Cell growth and death
   04210 Apoptosis
    103014668
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103014668
   04530 Tight junction
    103014668
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103014668
   04621 NOD-like receptor signaling pathway
    103014668
   04625 C-type lectin receptor signaling pathway
    103014668
   04660 T cell receptor signaling pathway
    103014668
   04658 Th1 and Th2 cell differentiation
    103014668
   04659 Th17 cell differentiation
    103014668
   04657 IL-17 signaling pathway
    103014668
   04662 B cell receptor signaling pathway
    103014668
  09152 Endocrine system
   04912 GnRH signaling pathway
    103014668
   04915 Estrogen signaling pathway
    103014668
   04921 Oxytocin signaling pathway
    103014668
   04926 Relaxin signaling pathway
    103014668
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103014668
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103014668
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014668
   05203 Viral carcinogenesis
    103014668
   05231 Choline metabolism in cancer
    103014668
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103014668
  09162 Cancer: specific types
   05210 Colorectal cancer
    103014668
   05211 Renal cell carcinoma
    103014668
   05224 Breast cancer
    103014668
  09163 Immune disease
   05323 Rheumatoid arthritis
    103014668
   05321 Inflammatory bowel disease
    103014668
  09165 Substance dependence
   05030 Cocaine addiction
    103014668
   05031 Amphetamine addiction
    103014668
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103014668
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103014668
   04933 AGE-RAGE signaling pathway in diabetic complications
    103014668
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103014668
   05135 Yersinia infection
    103014668
   05133 Pertussis
    103014668
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103014668
   05170 Human immunodeficiency virus 1 infection
    103014668
   05161 Hepatitis B
    103014668
   05171 Coronavirus disease - COVID-19
    103014668
   05162 Measles
    103014668
   05167 Kaposi sarcoma-associated herpesvirus infection
    103014668
   05169 Epstein-Barr virus infection
    103014668
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103014668
   05142 Chagas disease
    103014668
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103014668
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103014668
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    103014668
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch NBP1 Jnk-SapK_ap_N Fib_alpha DUF3450 TMF_DNA_bd Seryl_tRNA_N
Other DBs
NCBI-GeneID: 103014668
NCBI-ProteinID: XP_007164427
UniProt: A0A383YNL1
LinkDB
Position
Un
AA seq 253 aa
MTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQF
LCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVSGSGLVAPAVASVAGAQPQQ
QPPPPPPPPPHHLPQQIPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERK
RMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNS
GCQLMLTQQLQTF
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaccctgaacctggccgaccccgtgggcagcctgaagccgcacctccgggccaagaac
tccgatctcctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggag
cgcctgataatccagtccagcaacgggcacatcaccaccacgccgacccccacccagttc
ctgtgtcccaagaacgtgacggacgagcaggagggcttcgccgagggcttcgtgcgcgcc
ctggccgaactgcacagccagaacacgctgcccagcgtcacgtctgcggcgcagccggtc
agcgggtcgggcctggtggctccagccgtggcctcggtggcgggcgcgcagcctcagcag
cagccgccgccgccgccgccgccgccgccgcaccacctgccccagcagatccccgtgcag
cacccgcggctgcaggccctgaaggaggagccgcagacggtccccgagatgcccggggaa
acgccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagaggaag
cgcatgaggaaccgcatcgctgcctccaagtgccggaaaaggaagctggagaggatcgcc
cggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccactgcc
aacatgctcagggaacaggtggcccagcttaagcagaaagtcatgaaccacgttaacagt
gggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system