KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001464
Entry
103001464         CDS       T03086                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04151  PI3K-Akt signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04934  Cushing syndrome
bacu05162  Measles
bacu05165  Human papillomavirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05206  MicroRNAs in cancer
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103001464 (CDKN1B)
   04066 HIF-1 signaling pathway
    103001464 (CDKN1B)
   04068 FoxO signaling pathway
    103001464 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    103001464 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103001464 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001464 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    103001464 (CDKN1B)
   05206 MicroRNAs in cancer
    103001464 (CDKN1B)
   05203 Viral carcinogenesis
    103001464 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    103001464 (CDKN1B)
   05220 Chronic myeloid leukemia
    103001464 (CDKN1B)
   05215 Prostate cancer
    103001464 (CDKN1B)
   05222 Small cell lung cancer
    103001464 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103001464 (CDKN1B)
   04934 Cushing syndrome
    103001464 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    103001464 (CDKN1B)
   05169 Epstein-Barr virus infection
    103001464 (CDKN1B)
   05165 Human papillomavirus infection
    103001464 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103001464 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103001464
NCBI-ProteinID: XP_007196113
UniProt: A0A384B9A7
LinkDB
Position
Un
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGNLPEFYYRPPRPPKGACKVPAQEGQDVSGTRQAVPLIG
SQANSEDTHLVDQKTDAPDSQTGLAEQCTGIRKRPATDDSSPQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagcccgagcctggagcggatggacgccagacag
gcggagtaccccaagccctcggcctgcagaaacctcttcggcccggtcaaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggccagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaagaggtggaa
aagggcaacttgcccgagttctactacagacccccgcggccacccaaaggcgcctgcaag
gtgccggcgcaggagggccaggatgtcagtgggacccgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcatttggtagaccagaagactgatgcaccggacagc
cagacggggttagcggagcagtgcactgggataaggaagcgacctgccacagacgattcc
tctcctcaaaacaaaagagcaaacagaacagaagaaaatgtttcagacggttccccgaac
gcgggttcagtggagcagacgcccaagaagcccggcctcagaaggcgtcaaacgtaa

DBGET integrated database retrieval system