KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001593
Entry
103001593         CDS       T03086                                 

Gene name
KITLG
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04640  Hematopoietic cell lineage
bacu04916  Melanogenesis
bacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103001593 (KITLG)
   04014 Ras signaling pathway
    103001593 (KITLG)
   04015 Rap1 signaling pathway
    103001593 (KITLG)
   04072 Phospholipase D signaling pathway
    103001593 (KITLG)
   04151 PI3K-Akt signaling pathway
    103001593 (KITLG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103001593 (KITLG)
  09152 Endocrine system
   04916 Melanogenesis
    103001593 (KITLG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001593 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103001593 (KITLG)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103001593 (KITLG)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 103001593
NCBI-ProteinID: XP_007165978
UniProt: A0A383YT09
LinkDB
Position
Un
AA seq 274 aa
MKKTQTWIITCIYLQLLLFNPLVKTQGICRNRVTDDVKDVTKLVANLPKDYKITLKYVPG
MDVLPSHCWISEMVEQLSVSLTDLLDKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSF
ENVKKSSKSPEPRLFTPEKFFGIFNKSIDAFKDLKMVASKTSECVMSSTSSPEKDSRVSV
TKPFMLPPVAASSLRNDSSSSNRKASNPIEDSSLQWAAVALPAFFSLVIGFAFGALYWKK
KQPNLTRAVENIQINEEDNEISMLQEKEREFQEV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactcaagggatctgcaggaaccgtgtgactgatgatgtgaaagacgtt
acaaaattggtggcaaatcttccaaaagactataagataaccctcaaatatgtccccggg
atggacgttttgcctagtcattgttggataagcgagatggtggaacaattgtcagtcagc
ttgactgatcttctggacaagttttcaaatatttctgaaggcttgagtaattactctatc
atagacaaacttgtgaaaatagtcgatgaccttgtggagtgcatggaagaacactcattt
gagaatgtaaaaaaatcatctaagagcccagaacctaggctgtttactcctgaaaaattc
tttggaatttttaataaatccatcgatgccttcaaggacttgaagatggtggcttctaaa
actagtgaatgtgtgatgtcttcaacatcaagtcctgaaaaagattccagagtcagtgtc
acaaaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagc
agtaataggaaggcctcaaatcccattgaagactccagcctacaatgggcagccgtagca
ttgccagcattcttttctcttgtaattgggtttgcttttggagccttatactggaagaag
aaacaaccaaatcttacaagggcagttgaaaatatacagattaatgaagaggataatgag
ataagtatgttgcaagaaaaagagagagagtttcaagaagtgtaa

DBGET integrated database retrieval system