KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001602
Entry
103001602         CDS       T03086                                 

Gene name
FGF8
Definition
(RefSeq) fibroblast growth factor 8
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103001602 (FGF8)
   04014 Ras signaling pathway
    103001602 (FGF8)
   04015 Rap1 signaling pathway
    103001602 (FGF8)
   04020 Calcium signaling pathway
    103001602 (FGF8)
   04151 PI3K-Akt signaling pathway
    103001602 (FGF8)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103001602 (FGF8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001602 (FGF8)
  09162 Cancer: specific types
   05226 Gastric cancer
    103001602 (FGF8)
   05218 Melanoma
    103001602 (FGF8)
   05224 Breast cancer
    103001602 (FGF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103001602 (FGF8)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103001602 (FGF8)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103001602 (FGF8)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103001602 (FGF8)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103001602
NCBI-ProteinID: XP_007187369
UniProt: A0A384AJG6
LinkDB
Position
Un
AA seq 244 aa
MGSPRSALSCLLLHLLVLCLQAQEGPGGGPALGRELASLFRAGRESQGVSQQVTVQSSPN
FTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETD
TFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYM
AFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWA
PEPR
NT seq 735 nt   +upstreamnt  +downstreamnt
atgggcagcccccgctcggcgctgagctgcctgctgttgcacttgctggttctctgcctc
caagcccaggaaggcccgggcggggggcctgcgctgggcagggagctcgcttccctgttc
cgagctggccgggagtcccagggtgtttcccaacaggtaactgttcagtcctcacctaat
tttacacagcatgtgagggagcagagcctggtgacggatcagctcagccgccgtctcatc
cggacctaccaactctacagccgcaccagcgggaagcacgtgcaggtcctggccaacaag
cgcatcaacgccatggcagaagacggggacccctttgcaaagctcattgtggagacggac
acctttgggagccgggttcgagtccggggagctgagacaggcctctacatctgcatgaac
aagaaggggaagctgattgccaagagcaacggcaaaggcaaggattgtgtgttcacggag
atcgtgctggagaacaactacacggccctgcagaacgccaagtacgagggctggtacatg
gccttcacgcgcaagggtcggccccgcaagggctccaagactcggcagcaccagcgcgag
gtccacttcatgaagcgactgccccgcggccatcacaccacagagcagagcctgcgcttc
gagttcctcaactacccgcccttcacgcgcagtctgcgcggcagccagaggacttgggcc
ccagagccccgatag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002427
Entry
103002427         CDS       T03086                                 

Gene name
FGF6
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002427 (FGF6)
   04014 Ras signaling pathway
    103002427 (FGF6)
   04015 Rap1 signaling pathway
    103002427 (FGF6)
   04020 Calcium signaling pathway
    103002427 (FGF6)
   04151 PI3K-Akt signaling pathway
    103002427 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103002427 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002427 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    103002427 (FGF6)
   05218 Melanoma
    103002427 (FGF6)
   05224 Breast cancer
    103002427 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103002427 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103002427 (FGF6)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103002427 (FGF6)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103002427 (FGF6)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103002427
NCBI-ProteinID: XP_007170273
UniProt: A0A383Z534
LinkDB
Position
Un
AA seq 208 aa
MALGQRLVITMSRGAGRLPGTLRALIFLGVLVGMVVPSPAGSRTNSTLLASRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVPPDGRISGTHEENPYSLLEI
STVERGVVSLFGVKSALFVAMNSKGRLYTTPSFQEECKFRETLLPNNYNAYESDLYRGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggccctgggacagaggctggtcatcactatgtcccggggagcaggacgtctgccgggc
acgctacgggctctcatcttcctcggcgtccttgtgggcatggtggtgccctctcccgcg
ggctcccgcaccaacagcacgctgctggcttccaggggctggggcaccctgctgtccagg
tctcgggctgggctggctggagagattgctggcgtgaactgggaaagcggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggcttccacctccaggtg
ccccccgacggccggatcagcggcacccacgaggagaacccctacagcctgctggagatt
tccacagtggagcgaggcgtggtgagtctgtttggggtgaagagtgccctcttcgttgcc
atgaacagtaaaggaagattatacaccacgcccagcttccaagaggagtgcaaattcaga
gagaccctcctgcccaacaattacaacgcctatgagtcagacctgtaccgaggcacctac
atcgcgctgagcaaatacggacgggtgaagcggggcagcaaggtgtccccgatcatgacc
gtcactcacttcctccccaggatataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004048
Entry
103004048         CDS       T03086                                 

Gene name
FGF9
Definition
(RefSeq) fibroblast growth factor 9
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103004048 (FGF9)
   04014 Ras signaling pathway
    103004048 (FGF9)
   04015 Rap1 signaling pathway
    103004048 (FGF9)
   04020 Calcium signaling pathway
    103004048 (FGF9)
   04151 PI3K-Akt signaling pathway
    103004048 (FGF9)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103004048 (FGF9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004048 (FGF9)
  09162 Cancer: specific types
   05226 Gastric cancer
    103004048 (FGF9)
   05218 Melanoma
    103004048 (FGF9)
   05224 Breast cancer
    103004048 (FGF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103004048 (FGF9)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103004048 (FGF9)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103004048 (FGF9)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103004048 (FGF9)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103004048
NCBI-ProteinID: XP_007164279
UniProt: A0A383YN64
LinkDB
Position
Un
AA seq 208 aa
MAPLGEVGNYFGVQDAAPFGNVPVLPADSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGI
LRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNE
KGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRFYVALNKDGTPREGTRTKR
HQKFTHFLPRPVDPDKVPELYKGILSQS
NT seq 627 nt   +upstreamnt  +downstreamnt
atggctcccctaggtgaagttgggaactatttcggtgtgcaggatgcggcaccgtttggg
aatgtgcccgtgttgccggcggacagcccggttttgttaagtgaccacctgggtcagtcc
gaagcaggggggcttcccaggggacctgcagtcacggacttggatcatttaaaggggatt
ctcaggcggaggcagctctactgcaggactggatttcacttagaaatcttccccaatggt
actatccagggaaccaggaaagaccacagccgatttggcatcctggagtttatcagtata
gcggtgggcctggtcagcattcgaggcgtggacagcggactctacctcggcatgaatgag
aagggggagctgtacggatcagaaaaactaacccaagagtgtgtattcagagaacagttt
gaagaaaactggtataacacgtactcctcgaatctgtacaaacacgtggacactggaagg
cggttctatgtcgcgttaaataaggacgggacccccagagaaggaacgaggactaaacgg
caccagaaattcacacattttttacccagaccagtggaccccgacaaagtacccgaactc
tataagggtatcctaagccaaagttga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103009981
Entry
103009981         CDS       T03086                                 

Definition
(RefSeq) fibroblast growth factor 10-like
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103009981
   04014 Ras signaling pathway
    103009981
   04015 Rap1 signaling pathway
    103009981
   04020 Calcium signaling pathway
    103009981
   04151 PI3K-Akt signaling pathway
    103009981
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103009981
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103009981
  09162 Cancer: specific types
   05226 Gastric cancer
    103009981
   05218 Melanoma
    103009981
   05224 Breast cancer
    103009981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103009981
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103009981
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103009981
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103009981
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103009981
NCBI-ProteinID: XP_007195620
UniProt: A0A384B7G3
LinkDB
Position
Un
AA seq 210 aa
MWKWILTHCASAFPHLRACCCCFLLLFLVSSVPVTCQALGQGMVSPEATNSSSSSSSSSF
SSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIENGKVSGTKKENCPYSILEITSVEI
GVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYV
ALNGKGAPRRGQKTRRKNTSAHFLPMVVHS
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtggaaatggatattgacacattgtgcctcagcctttccccacctgcgcgcctgctgc
tgctgcttcttgttgctgttcttagtgtcttccgtccctgtcacctgccaagcccttggt
cagggcatggtgtcaccagaggccaccaactcctcttcttcctcgtcctcctcgtctttc
tcctctccttccagtgcggggaggcatgtgcggagctacaatcacctccaaggagatgtc
cgctggagaaagctcttctctttcaccaagtactttctcaagattgagaacgggaaggtc
agcggtaccaagaaggagaactgcccgtacagtatcttggagataacttcagtggaaatt
ggagttgttgccgtcaaagccattaacagcaactattatttagccatgaacaagaagggg
aaactctatggctcaaaagaatttaacaatgactgtaagctgaaggagaggattgaggaa
aacggatacaatacctatgcatcctttaactggcagcacaatgggaggcaaatgtatgtg
gcattgaatggaaaaggagctcccaggagaggacagaaaacacgaaggaaaaacacctca
gctcattttcttccaatggtggtacactcatag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012083
Entry
103012083         CDS       T03086                                 

Gene name
FGF19
Definition
(RefSeq) fibroblast growth factor 19
  KO
K22603  fibroblast growth factor 19
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012083 (FGF19)
   04014 Ras signaling pathway
    103012083 (FGF19)
   04015 Rap1 signaling pathway
    103012083 (FGF19)
   04020 Calcium signaling pathway
    103012083 (FGF19)
   04151 PI3K-Akt signaling pathway
    103012083 (FGF19)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103012083 (FGF19)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012083 (FGF19)
  09162 Cancer: specific types
   05226 Gastric cancer
    103012083 (FGF19)
   05218 Melanoma
    103012083 (FGF19)
   05224 Breast cancer
    103012083 (FGF19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103012083 (FGF19)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103012083 (FGF19)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103012083 (FGF19)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103012083 (FGF19)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103012083
NCBI-ProteinID: XP_007171329
LinkDB
Position
Un
AA seq 357 aa
MPMPMPMPIPILTPIIIIMTSTASGSISGDCRAGRRRDGDGAQSQAGPKPGLKRHLALAR
ATPLFLREWRSRPVPSWGTIYWDLGGLGGVTRAGPSERLSRGRGSPEPEGGAMRSAPSRC
AVARALVLAGLWLAAAGRPLAFSDAGPHVHYGWGESVRLRHLYTPGPQGLSSCFLRIHSD
GAVDCAPVQSAHSLMEIRAVALSTVAIKGERSVLYLCMGADGKMQGLSQYSAEDCAFEEE
IRPDGYNVYWSKKHHLPVSLSSARQRQLFKSRGFLPLSHFLPMLSTIPTEPDEIQDHLKP
DLFALPLKTDSMDPFGLATNLGVVKSPSFYKHFPVRDDKTVPSSFGFSSVLLQPRQG
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgcccatgcccatgcccatgcccatccccatcctcacccccatcatcatcatcatgacc
agcacagcgtctggctccatctccggggactgccgggccgggcggaggcgggacggcgac
ggggcgcagagccaagccgggccgaaaccggggctgaagcgccatctagcgctcgcccgc
gcgaccccattgttcctccgagagtggaggtcgcgcccggtccccagttgggggacaatt
tactgggatctgggcggcctgggcggggtcacccgggcggggcccagcgagaggctgagt
cgggggcggggtagccccgagcccgagggaggtgccatgcggagcgctccgagccggtgc
gccgtggcccgcgccctggtcctggccggcctctggctggctgcagccgggcgcccccta
gccttctcggatgccgggccgcacgtgcactacggctggggcgagtccgtccgcctgcgg
cacctgtacaccccgggcccccagggcctctccagctgcttcctgcgcatccactcagac
ggcgccgtggactgcgcgccggttcagagcgcgcacagtttgatggagatcagggcagtc
gctctgagtaccgtggccatcaagggcgagcgcagcgtcctgtacctctgcatgggcgcc
gacggcaaaatgcaagggctgagccagtactcggccgaggattgtgcttttgaggaggaa
atccgtccggacggctacaacgtgtactggtccaagaaacaccatctcccggtctccctg
agcagcgccaggcagaggcagctgttcaaaagcaggggctttctgccgctgtctcacttc
ctccccatgctgtccaccatcccaacagagcccgatgaaatccaggaccacttgaagccc
gatttgtttgctttgcccctgaaaacagatagcatggacccgtttgggctcgccaccaat
ctgggagtggtgaagagtcccagcttctataagcactttcctgttcgtgatgacaagacg
gtccccagcagcttcggcttctcttccgtcctcctgcagcctcggcaggggtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012368
Entry
103012368         CDS       T03086                                 

Definition
(RefSeq) fibroblast growth factor 2-like
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012368
   04014 Ras signaling pathway
    103012368
   04015 Rap1 signaling pathway
    103012368
   04020 Calcium signaling pathway
    103012368
   04151 PI3K-Akt signaling pathway
    103012368
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103012368
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012368
  09162 Cancer: specific types
   05226 Gastric cancer
    103012368
   05218 Melanoma
    103012368
   05224 Breast cancer
    103012368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103012368
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103012368
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103012368
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103012368
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103012368
NCBI-ProteinID: XP_007171330
UniProt: A0A383Z7Z9
LinkDB
Position
Un
AA seq 252 aa
MVLSAYMGAFEDRGSTGSQRRNKFRGVPERQSARSDFSELRVPDEGGTQAAGTEAEKRPH
GDGTGRDKVEEAKLRLQDESGGDARVGTNRSMGPTKPGVGAGDPPARVAPGAWGLRRSPP
ASSPTVHSLPPAQAVHSRKPPQAQLGPRLPGRTDLPTDARLLELSPVERGVVSVFGVASR
FFVAMSSRGKLYGSPFFTDECKFKEILLPNNYNAYECYRYPGMFIALSKNGKTKKGNRVS
PTMKVTHFLPRL
NT seq 759 nt   +upstreamnt  +downstreamnt
atggtgctgtcagcgtacatgggtgcttttgaggaccgtgggtccacagggtcccagcga
aggaacaagttccggggagtccctgaaaggcaaagcgcaaggagtgacttctctgagctg
agggtaccagatgagggcggcacccaggccgctggaacagaggcggagaagaggccccac
ggagacgggacaggcagggacaaagtggaagaagcaaaacttcggctgcaagacgagagt
ggaggagacgcgagggtcggcaccaacaggtccatgggcccaacgaagccaggggtgggg
gccggggaccctccagcccgggtagctcccggcgcctgggggctccgtcgctcgcctccg
gcttcttccccgaccgtgcactccctgcccccggcccaggccgtgcactcccgcaagccc
ccacaggcgcagctcggcccccggcttcccgggcgcaccgacctacccacggacgcacgc
ctgctggagctctcgcccgtggagcggggagtggtgagcgtcttcggcgtggccagccgg
ttcttcgtggccatgagcagcaggggcaagctctacggctcgcctttcttcaccgatgag
tgcaagttcaaagagatactcctccccaacaactacaacgcctacgagtgctacaggtac
cccggcatgttcatcgccctgagtaagaacgggaagaccaagaaggggaaccgggtgtca
cccaccatgaaggtcacccatttcctccccaggctgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012419
Entry
103012419         CDS       T03086                                 

Gene name
FGF5
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012419 (FGF5)
   04014 Ras signaling pathway
    103012419 (FGF5)
   04015 Rap1 signaling pathway
    103012419 (FGF5)
   04020 Calcium signaling pathway
    103012419 (FGF5)
   04151 PI3K-Akt signaling pathway
    103012419 (FGF5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103012419 (FGF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012419 (FGF5)
  09162 Cancer: specific types
   05226 Gastric cancer
    103012419 (FGF5)
   05218 Melanoma
    103012419 (FGF5)
   05224 Breast cancer
    103012419 (FGF5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103012419 (FGF5)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103012419 (FGF5)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103012419 (FGF5)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103012419 (FGF5)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103012419
NCBI-ProteinID: XP_007165666
UniProt: A0A383YSE2
LinkDB
Position
Un
AA seq 270 aa
MSLSFLFLLFLSHLILSAWAQGEKRLAPKGQPGPAATGRNAGGASSSRSSSSTKSSSSSS
ASSSPGASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANTL
SILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAI
HRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTAPEKKK
PPNPIKPKVPLSAPRRSPNTVKYRLKFRFG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgagcttgtccttcctcttcctgctcttcctcagccacctgatcctcagcgcctgggct
caaggggagaagcgcctcgcacccaaagggcaacccggaccggctgccaccggtaggaac
gctggaggagccagcagcagccggagcagcagtagcacgaagtcttcctcttcttcctct
gcctcctcctcccccggggcttctctgggcagtcaaggaagtggcttggagcagagcagt
ttccagtggagcccctcggggcgccggaccggcagcctctactgcagagtgggcatcggt
ttccatctgcagatctacccggatggcaaagtcaatggctcccacgaagccaatacgtta
agtattttggaaatatttgctgtgtctcaggggattgtaggaatacgaggagttttcagc
aacaaatttttagcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagat
gactgcaagttcagggagcgatttcaagaaaacagctataatacctatgcctcagcaata
cacagaactgaaaaaacggggcgggagtggtacgtggccctgaataagagagggaaagct
aaacggggctgcagtccccgtgttaaacctcagcacatctctacccactttctgccaaga
ttcaagcaatcagagcagccagaactttctttcacagttactgctcctgaaaagaaaaag
ccacctaatcccatcaagccaaaggttcccctttccgcacctcggagaagtcccaacaca
gtgaaatacagactcaagtttcgctttggatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013036
Entry
103013036         CDS       T03086                                 

Gene name
FGF20
Definition
(RefSeq) fibroblast growth factor 20
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103013036 (FGF20)
   04014 Ras signaling pathway
    103013036 (FGF20)
   04015 Rap1 signaling pathway
    103013036 (FGF20)
   04020 Calcium signaling pathway
    103013036 (FGF20)
   04151 PI3K-Akt signaling pathway
    103013036 (FGF20)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103013036 (FGF20)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013036 (FGF20)
  09162 Cancer: specific types
   05226 Gastric cancer
    103013036 (FGF20)
   05218 Melanoma
    103013036 (FGF20)
   05224 Breast cancer
    103013036 (FGF20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103013036 (FGF20)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103013036 (FGF20)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103013036 (FGF20)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103013036 (FGF20)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103013036
NCBI-ProteinID: XP_007174092
UniProt: A0A383ZG82
LinkDB
Position
Un
AA seq 211 aa
MAPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAELGARGGPGAAELAHL
HGILRRRQLYCRTGFHLQILPDGSVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG
MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGAR
SKRHQKFTHFLPRPVDPERVPELYKDLLMYS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggctcccttagccgaggtcgggggcttcctgggcggcctggagggcttgggccagcag
gtgggctcgcacttcctgctgcctcctgccggggagcggccgcctctgctgggcgagcgc
cggggcgcggcggagctgggcgcccgcggcgggcccggggctgcggagctggcgcacctg
cacggcatcctgcgccgccggcagctctactgccgcaccggcttccacctgcagatcctg
cccgacggcagcgtgcagggcaccaggcaggaccacagcctcttcggtatcctggaattc
atcagtgtggcagtgggactggtcagtattagaggtgtggacagtggtctttaccttgga
atgaatgacaaaggagaactctatggatcagagaaactgacttctgaatgcatctttagg
gagcaatttgaagagaactggtataatacctattcatccaacatatataaacatggagac
actggccgtaggtattttgtggcacttaacaaagacggaactccaagagatggtgccaga
tccaaaagacaccagaaatttacacatttcctgcctagaccagtggatccagaaagagtt
cctgaactgtacaaggacctactaatgtacagttga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015722
Entry
103015722         CDS       T03086                                 

Gene name
FGF2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04810  Regulation of actin cytoskeleton
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103015722 (FGF2)
   04014 Ras signaling pathway
    103015722 (FGF2)
   04015 Rap1 signaling pathway
    103015722 (FGF2)
   04020 Calcium signaling pathway
    103015722 (FGF2)
   04151 PI3K-Akt signaling pathway
    103015722 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103015722 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103015722 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103015722 (FGF2)
   05205 Proteoglycans in cancer
    103015722 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    103015722 (FGF2)
   05218 Melanoma
    103015722 (FGF2)
   05224 Breast cancer
    103015722 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103015722 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103015722 (FGF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103015722 (FGF2)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103015722 (FGF2)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103015722 (FGF2)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103015722 (FGF2)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103015722
NCBI-ProteinID: XP_007172449
LinkDB
Position
Un
AA seq 155 aa
MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV
KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY
SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcagccgggagcatcaccacgctgcccgccctgccggaggacggcggcagcggcgcc
ttcccgcccggccacttcaaggaccccaagcggctgtactgcaaaaacgggggcttcttc
ctgcgcatccaccccgacggccgagtggatggggtccgcgagaagagcgaccctcacgtc
aaactacaacttcaagcagaagagagaggggttgtgtctatcaaaggagtgtgtgcgaac
cgttaccttgctatgaaggaagatggaagattactggcttctaaatgtgttacagacgag
tgtttcttttttgaacgattggaatctaataactacaatacttaccggtcaaggaaatac
tccagttggtatgtggcactgaaacgaactgggcagtataaacttggacccaaaacagga
cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016083
Entry
103016083         CDS       T03086                                 

Gene name
FGF21
Definition
(RefSeq) fibroblast growth factor 21
  KO
K22429  fibroblast growth factor 21
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04714  Thermogenesis
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103016083 (FGF21)
   04014 Ras signaling pathway
    103016083 (FGF21)
   04015 Rap1 signaling pathway
    103016083 (FGF21)
   04020 Calcium signaling pathway
    103016083 (FGF21)
   04151 PI3K-Akt signaling pathway
    103016083 (FGF21)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103016083 (FGF21)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103016083 (FGF21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103016083 (FGF21)
  09162 Cancer: specific types
   05226 Gastric cancer
    103016083 (FGF21)
   05218 Melanoma
    103016083 (FGF21)
   05224 Breast cancer
    103016083 (FGF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103016083 (FGF21)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103016083 (FGF21)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103016083 (FGF21)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103016083 (FGF21)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103016083
NCBI-ProteinID: XP_007168312
UniProt: A0A383YZK1
LinkDB
Position
Un
AA seq 208 aa
MGWDKAKFEHLGLWVPVLAVLLGACRAHPIPDSSPLLQFGGQVRQRYLYTDDAQETEAHL
EIRADGTVVGTARQSPESLLELKALKPGVIQILGVKTSRFLCQGPEGRLYGSLHFDPQAC
SFRELLLEDGYNIYQSEALGLPLRLPPRRSSNWDLAPRGPARFLPLPGFLPAPLEPPGIL
APEPPDVGSSDPLSMVGPSHGRSPSYTS
NT seq 627 nt   +upstreamnt  +downstreamnt
atgggctgggacaaggccaaattcgagcacctgggactgtgggtccccgtgctagctgtc
ctgctgggagcctgccgggcacatcccattcctgactccagccccctcctccaatttggg
ggccaagtccgccagcgatacctctacacggatgacgcccaggagacggaggcccacctg
gagatcagggccgatggcacagtggtggggacggcccgccagagccccgaaagtcttctg
gagctgaaagccctaaagccaggggtcattcaaatcttgggagttaaaacatccaggttc
ctgtgccaggggccagaggggaggctgtatggatcgctccacttcgacccccaggcctgc
agcttccgggagctgcttctcgaggatggatacaacatttaccagtctgaggctcttggc
cttccactccgcctgcccccgcgccgctcctccaactgggacctggccccccggggacct
gctcgcttcctgccgctgccaggcttcctcccggcacccctggagcctccagggatcttg
gcccccgagcctcccgacgtgggctcctcggaccccctgagcatggtgggaccttcacat
ggccgaagccccagctacacttcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017322
Entry
103017322         CDS       T03086                                 

Gene name
FGF23
Definition
(RefSeq) fibroblast growth factor 23
  KO
K22428  fibroblast growth factor 23
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017322 (FGF23)
   04014 Ras signaling pathway
    103017322 (FGF23)
   04015 Rap1 signaling pathway
    103017322 (FGF23)
   04020 Calcium signaling pathway
    103017322 (FGF23)
   04151 PI3K-Akt signaling pathway
    103017322 (FGF23)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103017322 (FGF23)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103017322 (FGF23)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017322 (FGF23)
  09162 Cancer: specific types
   05226 Gastric cancer
    103017322 (FGF23)
   05218 Melanoma
    103017322 (FGF23)
   05224 Breast cancer
    103017322 (FGF23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103017322 (FGF23)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103017322 (FGF23)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103017322 (FGF23)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103017322 (FGF23)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103017322
NCBI-ProteinID: XP_007170323
UniProt: A0A383Z583
LinkDB
Position
Un
AA seq 231 aa
MLGACLGLWVCTLGCAVHAYPNTSPLLGSSWGGLTHLYTATARNSYHLQIHRDGHVDGSP
QQTIYSALMIRSEDAGFVVITGVMSRRYLCMDLRGNIFGSPTFVQVRRQTEATSEPKTKG
RERAGLRPESRHRGAGSDQPGPRQPSASGGSPGGAARSPRLSPPASRNRSSEMSGNHFCP
AGHHGVKGKARAEWDSGPAASDPLGVLRGLRLDARAGPGGAERCRPFPSFA
NT seq 696 nt   +upstreamnt  +downstreamnt
atgctgggggcctgcctgggcctctgggtctgcaccctgggctgtgcggtccacgcctat
cccaacacgtccccgctgctgggctccagctggggtggcctgacccatctgtacacggcc
acggccaggaacagctaccacctgcagatccacagggacggccacgtggatggctcaccc
cagcagaccatctacagtgccctgatgatcagatctgaggatgcaggcttcgtggtgata
acaggggtgatgagcaggagatatctctgcatggacctcagaggcaacatttttggatct
cccaccttcgtccaggtgaggagacagaccgaagccacctctgagccaaaaacaaaaggc
agagagagggcaggcctccgtccagaaagcagacacagaggcgccggctccgaccagccc
ggccccaggcagccaagtgccagcggcgggtccccaggcggggccgcgaggtccccaagg
ctgtccccacctgccagtcgtaaccgcagttcggaaatgagtggaaatcacttttgccca
gcagggcaccacggggttaaaggcaaggcccgagcagagtgggacagcggccctgcggcc
agcgacccgctcggggtgctccgcggcctccggctggacgcgcgcgccgggccggggggc
gccgagcgctgccggcccttccccagcttcgcttag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017891
Entry
103017891         CDS       T03086                                 

Gene name
FGF18
Definition
(RefSeq) fibroblast growth factor 18
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017891 (FGF18)
   04014 Ras signaling pathway
    103017891 (FGF18)
   04015 Rap1 signaling pathway
    103017891 (FGF18)
   04020 Calcium signaling pathway
    103017891 (FGF18)
   04151 PI3K-Akt signaling pathway
    103017891 (FGF18)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103017891 (FGF18)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017891 (FGF18)
  09162 Cancer: specific types
   05226 Gastric cancer
    103017891 (FGF18)
   05218 Melanoma
    103017891 (FGF18)
   05224 Breast cancer
    103017891 (FGF18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103017891 (FGF18)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103017891 (FGF18)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103017891 (FGF18)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103017891 (FGF18)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103017891
NCBI-ProteinID: XP_007171458
LinkDB
Position
Un
AA seq 282 aa
MWESKDVPHLTAFLGTAACPVPAAFAPWREVIAPRRRIPTASSAHQLQPSCWLCSFGAAG
PVAESLSASLQPGAARRRRRRQWRGCGRQLTVTPFPAQVLVAEENVDFRIHVENQTRARD
DVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETE
FYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKT
RENQQDVHFMKRYPKGQAELQKPFKYTTVTKRSRRIRPTHPG
NT seq 849 nt   +upstreamnt  +downstreamnt
atgtgggagagtaaggacgttccgcacctaactgcgttcttggggaccgcagcctgtcca
gttccggcagcgtttgcgccgtggcgcgaggtcattgcgcccaggcgcagaattccgacg
gcttcgagcgctcaccagctccagcctagctgctggctctgctccttcggagctgccggt
cccgtcgccgagagtctgagcgcctccctccaacccggagccgccaggagaaggaggagg
aggcagtggagaggctgcggcaggcagctcactgtcacccctttccctgctcaggtgctg
gtggccgaggagaacgtggacttccgcatccatgtggagaaccagacgcgggctcgggac
gatgtgagccgtaagcagctgcggctgtaccagctctacagccggaccagcgggaagcac
attcaggtcctgggccgtaggatcagcgcccgcggcgaggacggggacaagtatgcccag
ctcctagtggagacagataccttcggtagtcaagtccggatcaagggcaaggagacggaa
ttctacctgtgtatgaaccggaaaggcaagcttgtggggaagcccgatggcaccagcaaa
gagtgtgtgttcatcgagaaggtcctggagaacaactacacagccctgatgtcggccaag
tactctggctggtacgtgggcttcaccaagaaggggcgaccacggaaaggccccaagacc
cgggagaaccagcaggacgtccacttcatgaagcgctaccccaagggacaggcagagctg
cagaagcccttcaagtacaccacagtgaccaagcggtcccggcggatccgccccacacac
cccggctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018238
Entry
103018238         CDS       T03086                                 

Gene name
FGF17
Definition
(RefSeq) fibroblast growth factor 17
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103018238 (FGF17)
   04014 Ras signaling pathway
    103018238 (FGF17)
   04015 Rap1 signaling pathway
    103018238 (FGF17)
   04020 Calcium signaling pathway
    103018238 (FGF17)
   04151 PI3K-Akt signaling pathway
    103018238 (FGF17)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103018238 (FGF17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018238 (FGF17)
  09162 Cancer: specific types
   05226 Gastric cancer
    103018238 (FGF17)
   05218 Melanoma
    103018238 (FGF17)
   05224 Breast cancer
    103018238 (FGF17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103018238 (FGF17)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103018238 (FGF17)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103018238 (FGF17)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103018238 (FGF17)
SSDB
Motif
Pfam: FGF Fascin IL1
Other DBs
NCBI-GeneID: 103018238
NCBI-ProteinID: XP_007167976
UniProt: A0A383YYU2
LinkDB
Position
Un
AA seq 216 aa
MGAARLLPNLTLCLQLLILCCQTQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSR
TSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKKGKLIGKP
SGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQ
GQLPFPNHAERQKQFEFVGSAPTRRTKRTRRPQPLT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgggagccgcccgtctgctgcccaacctcacgctgtgcctgcagctgctgattctctgc
tgtcaaactcagggggagaatcacccgtctcctaattttaaccagtacgtgagggaccag
ggtgccatgaccgaccagctgagccggcggcagatccgcgagtaccagctctacagccgg
accagcggcaagcacgtgcaggtcactgggcgtcgcatctccgccaccgctgaggacggc
aacaagtttgccaagctcatagtggagacagacaccttcggaagccgggtgcgcatcaag
ggagctgagagcgagaaatacatctgtatgaacaagaagggcaagctcatcgggaagccc
agcggaaagagcaaagactgcgtgttcacagagatcgtgctggagaacaactacacagcg
ttccagaacgcccggcacgagggctggttcatggccttcacgcggcagggccggccccgc
caggcctcccgcagccgccagaaccagcgagaggctcacttcatcaagcgcctctaccag
ggccagctgcccttccccaaccacgccgagaggcagaagcagttcgagtttgtgggctca
gcccccacccgccggaccaagcgcactcggaggccacagcccctgacatag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018926
Entry
103018926         CDS       T03086                                 

Definition
(RefSeq) uncharacterized LOC103018926
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103018926
   04014 Ras signaling pathway
    103018926
   04015 Rap1 signaling pathway
    103018926
   04020 Calcium signaling pathway
    103018926
   04151 PI3K-Akt signaling pathway
    103018926
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103018926
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018926
  09162 Cancer: specific types
   05226 Gastric cancer
    103018926
   05218 Melanoma
    103018926
   05224 Breast cancer
    103018926
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103018926
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103018926
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103018926
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103018926
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103018926
NCBI-ProteinID: XP_007176753
LinkDB
Position
Un
AA seq 216 aa
MPPARGTTASPAPAGSCSPKAYGGREGTTRLESADRTTIPRGQRGAGGGGHAPSRGRARG
DKSRRRRAGRGAIRGRLWLGLAWLLLARAPGAAGTPNSPRRPRSYTHLEGDVRWRRLFST
HFFLCVDPSGRVQGTRWRDSPDSVFFELRPIRVSRRKTNMGGTSQGAGWTLTGQGSRVTR
MGDSLWMTRQLRGLGRLTSLTRGCAPRRTQIMQGRE
NT seq 651 nt   +upstreamnt  +downstreamnt
atgccgccagcacgcgggaccaccgcgtcgcccgcgcccgccgggagttgtagtcctaag
gcctacggcggccgcgaagggacaacgcgcctggagagcgccgacagaaccacaattccc
agggggcagcggggcgccggaggcggggggcatgcgccgagccgcggacgcgcgcgggga
gacaagagcaggcggcggcgagcagggcgcggggctatacgcggccgcctgtggctgggc
ctggcgtggctactgctggcacgggcgcccggcgccgcggggaccccgaacagtccgcgg
agaccgcgcagctacacgcatctggagggcgacgtgcgctggcggcgcctcttctccacc
cacttcttcctgtgtgtggatcccagcggccgcgtgcagggcacccgctggcgcgacagc
cctgacagcgtcttcttcgagttgcgccctatccgcgtgagcagacggaagaccaacatg
gggggcacttcccagggcgcaggctggacactcaccggccaaggcagccgtgtgacccgg
atgggggacagcctgtggatgacacgccagctgcgggggctcggccggctcacctccctg
acccggggctgcgccccccgacgcacacaaatcatgcagggccgcgagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018997
Entry
103018997         CDS       T03086                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04390  Hippo signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103018997 (FGF1)
   04014 Ras signaling pathway
    103018997 (FGF1)
   04015 Rap1 signaling pathway
    103018997 (FGF1)
   04390 Hippo signaling pathway
    103018997 (FGF1)
   04020 Calcium signaling pathway
    103018997 (FGF1)
   04151 PI3K-Akt signaling pathway
    103018997 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103018997 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103018997 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    103018997 (FGF1)
   05218 Melanoma
    103018997 (FGF1)
   05224 Breast cancer
    103018997 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103018997 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103018997 (FGF1)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103018997 (FGF1)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103018997 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103018997
NCBI-ProteinID: XP_007194219
UniProt: A0A384B4I1
LinkDB
Position
Un
AA seq 189 aa
MSEVCCSTKDFKALWGKKPIASSLESAITRSCSAMAEGEITTFTALTEKFNLPPGNYKKP
KLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDG
LLYGSQTPNEECLFLERLEENHYNTYASKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAIL
FLPLPVSSD
NT seq 570 nt   +upstreamnt  +downstreamnt
atgagtgaagtttgctgctcaaccaaagacttcaaggctctgtggggaaaaaagcctatt
gccagcagccttgaaagcgccataaccaggagctgctcagccatggctgaaggggaaatc
acaaccttcacagccctgaccgagaagtttaatctgcctccagggaattacaagaagccc
aaactcctctactgtagcaacgggggccacttcctgaggatccttccagacggcacagtg
gatgggacacgggacaggagtgaccagcacattcagctgcagctcagtgcggaaagcgtg
ggggaggtgtatataaagagtacggagactggccagtacttggccatggacaccgacggg
cttttgtacggctcacagacacccaatgaggaatgtttgttcctggaaaggttggaggag
aaccattacaacacctacgcatccaagaagcatgcagaaaagaattggttcgttggtctc
aagaagaacggaagctgcaaacgcggtcctcggactcactacggccagaaagcaatcttg
tttctccccctgccagtctcctctgattaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020278
Entry
103020278         CDS       T03086                                 

Gene name
FGF7
Definition
(RefSeq) fibroblast growth factor 7
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103020278 (FGF7)
   04014 Ras signaling pathway
    103020278 (FGF7)
   04015 Rap1 signaling pathway
    103020278 (FGF7)
   04020 Calcium signaling pathway
    103020278 (FGF7)
   04151 PI3K-Akt signaling pathway
    103020278 (FGF7)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103020278 (FGF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020278 (FGF7)
  09162 Cancer: specific types
   05226 Gastric cancer
    103020278 (FGF7)
   05218 Melanoma
    103020278 (FGF7)
   05224 Breast cancer
    103020278 (FGF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103020278 (FGF7)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103020278 (FGF7)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103020278 (FGF7)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103020278 (FGF7)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 103020278
NCBI-ProteinID: XP_007170491
UniProt: A0A383Z5W7
LinkDB
Position
Un
AA seq 194 aa
MRKWILTWILPSLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYME
GGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEYYLA
MNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTK
KEQKTAHFLPMAIT
NT seq 585 nt   +upstreamnt  +downstreamnt
atgcgcaaatggatactgacatggatcctgccaagtttgctctacagatcatgcttccac
attatctgtctagtgggcactatatctttagcttgcaatgacatgactccagagcaaatg
gctacaaatgtgaactgttccagccccgagcgacatacaagaagttatgattacatggaa
ggaggggatataagagtgagaagactcttctgtcgaacacagtggtatctgaggattgat
aaacgaggcaaagtcaaagggacccaagagatgaagaataattacaacatcatggaaatc
aggacagtggccgttggaattgtagcaatcaaaggagtggaaagtgaatattatcttgca
atgaacaaggaaggaaaactctatgcaaagaaagaatgcaatgaagattgtaacttcaaa
gaattaattctggaaaaccactacaacacatatgcatcagctaaatggacacacagtgga
ggagaaatgtttgttgccttaaatcaaaagggggttcctgtaagagggaaaaaaacgaag
aaagaacaaaaaacagcccactttcttcctatggcaataacctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020625
Entry
103020625         CDS       T03086                                 

Gene name
FGF16
Definition
(RefSeq) fibroblast growth factor 16
  KO
K04358  fibroblast growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05200  Pathways in cancer
bacu05218  Melanoma
bacu05224  Breast cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103020625 (FGF16)
   04014 Ras signaling pathway
    103020625 (FGF16)
   04015 Rap1 signaling pathway
    103020625 (FGF16)
   04020 Calcium signaling pathway
    103020625 (FGF16)
   04151 PI3K-Akt signaling pathway
    103020625 (FGF16)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103020625 (FGF16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020625 (FGF16)
  09162 Cancer: specific types
   05226 Gastric cancer
    103020625 (FGF16)
   05218 Melanoma
    103020625 (FGF16)
   05224 Breast cancer
    103020625 (FGF16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103020625 (FGF16)
   00536 Glycosaminoglycan binding proteins [BR:bacu00536]
    103020625 (FGF16)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103020625 (FGF16)
Glycosaminoglycan binding proteins [BR:bacu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103020625 (FGF16)
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 103020625
NCBI-ProteinID: XP_007184282
UniProt: A0A384AAD5
LinkDB
Position
Un
AA seq 146 aa
MRAKRLQNKFSLEDSKLDISDGNGIHFFALGILEFISLAVGLISIRGVDSGLYLGMNERG
ELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQ
KFTHFLPRPVDPSKLPSMSRDLFRYR
NT seq 441 nt   +upstreamnt  +downstreamnt
atgagagctaagaggctgcaaaacaagttcagcctagaggacagcaagcttgatatcagt
gatggaaatggcattcacttttttgctctaggaattctggagtttatcagcctggctgtg
gggctgatcagcatccggggagtggactctggcctgtatttaggaatgaacgagcgagga
gaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaagaa
aattggtacaacacctatgcctccaccttgtacaaacactcggactcggagagacagtat
tatgtggccctgaataaagacggctcaccccgggagggatacaggactaaacgacaccag
aaattcactcactttttacccaggccagtagatccttctaagttgccctccatgtccaga
gaccttttccgctataggtaa

DBGET integrated database retrieval system