KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001801
Entry
103001801         CDS       T03086                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04015  Rap1 signaling pathway
bacu04062  Chemokine signaling pathway
bacu04137  Mitophagy - animal
bacu04144  Endocytosis
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04625  C-type lectin receptor signaling pathway
bacu04727  GABAergic synapse
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04810  Regulation of actin cytoskeleton
bacu04912  GnRH signaling pathway
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu05100  Bacterial invasion of epithelial cells
bacu05135  Yersinia infection
bacu05152  Tuberculosis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05219  Bladder cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103001801 (SRC)
   04015 Rap1 signaling pathway
    103001801 (SRC)
   04370 VEGF signaling pathway
    103001801 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103001801 (SRC)
   04137 Mitophagy - animal
    103001801 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103001801 (SRC)
   04520 Adherens junction
    103001801 (SRC)
   04530 Tight junction
    103001801 (SRC)
   04540 Gap junction
    103001801 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103001801 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103001801 (SRC)
   04613 Neutrophil extracellular trap formation
    103001801 (SRC)
   04625 C-type lectin receptor signaling pathway
    103001801 (SRC)
   04062 Chemokine signaling pathway
    103001801 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103001801 (SRC)
   04915 Estrogen signaling pathway
    103001801 (SRC)
   04917 Prolactin signaling pathway
    103001801 (SRC)
   04921 Oxytocin signaling pathway
    103001801 (SRC)
   04926 Relaxin signaling pathway
    103001801 (SRC)
   04919 Thyroid hormone signaling pathway
    103001801 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    103001801 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103001801 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    103001801 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103001801 (SRC)
   05203 Viral carcinogenesis
    103001801 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    103001801 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103001801 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103001801 (SRC)
   05152 Tuberculosis
    103001801 (SRC)
   05100 Bacterial invasion of epithelial cells
    103001801 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103001801 (SRC)
   05168 Herpes simplex virus 1 infection
    103001801 (SRC)
   05163 Human cytomegalovirus infection
    103001801 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103001801 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103001801 (SRC)
   01522 Endocrine resistance
    103001801 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103001801 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103001801 (SRC)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     103001801 (SRC)
Protein kinases [BR:bacu01001]
 Non-receptor tyrosine kinases
  SRC family
   103001801 (SRC)
Membrane trafficking [BR:bacu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    103001801 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    103001801 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103001801 (SRC)
  Macropinocytosis
   Kinases
    103001801 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 103001801
NCBI-ProteinID: XP_007193210
UniProt: A0A384B0N7
LinkDB
Position
Un
AA seq 557 aa
MGSNKSKPKDASQRRRSLEPADNTHGGGGGGGGGAFPTSQTPSKPASADGHRGPSMAFAP
AAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNN
TRKVDVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRR
ESERLLLNVENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITS
RTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQG
CFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYI
VTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGE
SLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELT
TKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFL
EDYFTSTEPQYQPGENL
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggaacct
gctgataacacccatggcggcggcggcggcggcggcgggggtgccttccccacctcacag
acccccagcaagccggcctccgctgatggccaccggggccccagcatggcctttgcccct
gcagccgccgagcccaagctgttcggaggtttcaactcctccgacacagtcacctccccg
cagagggcggggcccctggctggcggagtgaccacctttgtggccctctatgactatgag
tcgcggacagagactgacctgtctttcaagaaaggggagcggctccagattgtcaacaac
acgaggaaggtggatgtcagccagacctggttcacattcagatggctgcaaagagaggga
gactggtggctggcccactcactcagcacaggacagacgggctacatccccagcaattac
gtggcgccctccgactccatccaggccgaggagtggtactttggcaagatcaccagacgg
gagtcagagcggttactgctcaatgtggagaacccaagagggactttcctagtgcgagaa
agcgagaccacaaaaggcgcctactgcctctcagtgtctgacttcgacaacgccaagggc
ctcaacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcc
cgcacccagttcaacagcctgcagcagctcgtggcctactactccaaacacgctgatggc
ctgtgccaccgcctcaccactgtgtgccccacgtccaagccacagactcagggcctggcc
aaggacgcctgggagatcccccgggagtcgctgcggctggaggtcaagctgggccagggc
tgcttcggagaggtgtggatggggacctggaatggcaccaccagggtggccatcaaaact
ctgaagcctggcacgatgtctccggaggccttccttcaggaggcccaggtcatgaagaag
ctgaggcatgagaagctggtgcagctgtacgcggtggtgtctgaggagcccatctacatc
gtcacggagtacatgagcaaggggagtttgctggactttctcaagggggagacgggcaag
tacctgcggctgcctcagctggtggacatggctgctcagatcgcttcaggcatggcgtac
gtggagcggatgaactatgtccaccgagacctccgtgctgccaacatcctggttggagag
agcctcgtgtgcaaagtggctgactttgggctggctcggctcatcgaagacaatgagtac
acagcccggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctat
ggccggttcaccatcaagtcagatgtgtggtcctttgggatcctgctgacagagctcacg
acaaagggacgggtgccctaccccgggatggtgaaccgcgaggtgctggaccaggtggag
aggggctaccggatgccctgccctcccgagtgtcccgagtctctgcatgacctcatgtgc
cagtgctggcggaaggacccagaggaacggcccaccttcgagtacctgcaggccttcctg
gaggactacttcacatccaccgagccccagtaccagcccggagagaacctatag

DBGET integrated database retrieval system