KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001827Help
Entry
103001827         CDS       T03086                                 

Gene name
PI16
Definition
(RefSeq) peptidase inhibitor 16
  KO
K20412  peptidase inhibitor 16
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bacu04090]
    103001827 (PI16)
CD molecules [BR:bacu04090]
 Proteins
  103001827 (PI16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP
Motif
Other DBs
NCBI-GeneID: 103001827
NCBI-ProteinID: XP_007198004
UniProt: A0A384BE77
LinkDB All DBs
Position
Un
AA seq 463 aa AA seqDB search
MHNFRSLLALLLLPLLLLGAAMGPAGALSDDEKHVMVKLHNLYRAQVSPPAANMLQMRWD
EELAAFAKAYAQQCVWGHNKERGRRGENLFAITDEGLDVPLAMEEWHHEREHYNLSAATC
ATGQMCGHYTQVVWAKTERIGCGAHFCEKLQGVEETNIHLLVCNYEPPGNVKGQRPYQEG
TPCSQCPLGYHCENSLCEPIRGPEEAQDLPYLVTEAPSSLATEASGSRKEGITSSLATET
PSFLVTEVSGSLATNGLPAVETKAPSSLVTEDSPSMATEAPLSLATEVPSFLATHSLLNL
DERPATLPKSTHDPTPKSADKEASSTRMPSRSPESSLQPKMSLTGTWEPLPNSQEEGEAE
AESPHSSEILASVFPAQDKPGEPQATLEHKGHTSSKSLSNSPSASATANAMGGRTLALQS
SLPGAEGPEKHGIKSGLNSSPGHVWGLLLGLLLLPPLVLAGIL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacttccgcagcctcctggcccttctgctgctgccgctgctactgctgggggct
gccatgggccccgccggagccctcagtgatgatgaaaagcacgtgatggtgaagctgcac
aatctctaccgagcccaggtgtccccgccggccgccaacatgctgcaaatgaggtgggac
gaggagctggccgccttcgccaaggcctacgcgcagcagtgcgtgtggggccacaacaag
gagcgcgggcggcgcggcgagaacctgttcgccatcacggatgagggcctggacgtgccg
ctggccatggaggagtggcaccacgagcgcgagcactacaacctcagcgccgccacctgc
gccacaggccagatgtgcggccactacacgcaggtggtctgggccaaaacagagaggatt
ggctgtggtgcccacttctgtgagaagctccagggcgttgaggagaccaatatccacttg
ctggtttgcaactatgagcccccggggaacgtgaaggggcagaggccctaccaggaggga
actccatgctcccaatgtcccttgggctaccactgcgaaaactccctgtgtgaacccatc
agaggcccggaagaggctcaggatttgccttacctagtaactgaggccccatcttccctg
gcaacagaagcctcaggctctaggaaagagggtatcacttcttccttagcaacggaaact
ccatccttcttggtaacagaggtctcaggctccctggcaacaaatggtctacctgctgta
gaaaccaaggccccatcttccttagtaacggaagactccccatccatggcaacagaggct
ccactttccttagcaactgaggtcccttcctttttggcaactcacagcctactcaacttg
gatgagagaccggctaccctccccaaatcaacccatgatcctacccccaaatcagcagac
aaagaggccagcagtacaagaatgccctccaggagcccagagagttctctgcagcccaag
atgtccttgacggggacatgggagccgctacccaactcccaggaggagggcgaggctgag
gccgagtcgcctcattccagtgagatcttggcctcagtttttccagcgcaggacaagcca
ggtgagccgcaggccacactggagcacaaggggcacacctcctccaagtccctgtccaac
tcccccagtgcctctgccaccgctaatgccatgggtgggcgtaccctggccctgcagtct
tccttgccaggtgcagagggccctgaaaagcatggcatcaagtcagggttgaactcgagc
cctgggcacgtctggggcctcctcctgggactgctgctactgcctcccctggtgctggct
ggaatcctctga

DBGET integrated database retrieval system