KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103001947
Entry
103001947         CDS       T03086                                 

Gene name
HEY1
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif 1
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04330  Notch signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103001947 (HEY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103001947 (HEY1)
  09162 Cancer: specific types
   05224 Breast cancer
    103001947 (HEY1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103001947 (HEY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103001947 (HEY1)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103001947 (HEY1)
SSDB
Motif
Pfam: HLH Hairy_orange HTH_Crp_2 dCache_2
Other DBs
NCBI-GeneID: 103001947
NCBI-ProteinID: XP_007185152
UniProt: A0A384ACV2
LinkDB
Position
Un
AA seq 304 aa
MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKR
RRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAM
DYRSLGFRECLAEVARYLSIIEGLDATDPLRVRLVSHLNNYASQREAASGAHAGLGHIPW
GSAFGHHPHVAHPLLLPQNGHGNTGTTASPTEPHHQGRLATAHPEASALRAPPSGSLGPV
LPVVTSASKLSPPLLSSVASLSAFPFSFGSFHLLSPNALSPSAPTQAANLGKPYRPWGTE
IGAF
NT seq 915 nt   +upstreamnt  +downstreamnt
atgaagcgagcccaccccgagtacagctcctccgatagcgagctggacgagaccatcgag
gtggaaaaggagagtgcggatgagaatgggaacttgagttcggcgctaggttccatgtcc
ccaactacatcttcacagatcttggccaggaaaagacggagaggcatcattgagaagcgc
cgacgagatcggatcaataacagtttgtctgagctgaggaggctggtacccagtgctttt
gagaagcagggatctgccaagctagaaaaagccgagatcctgcagatgacggtggatcac
ctgaaaatgctgcacactgcaggagggaaaggctattttgacgcgcacgcccttgctatg
gactatcggagtttggggtttcgggaatgcctggcagaagtcgcccgttacctgagcatc
attgaaggactagatgccacggacccgcttcgagttcgactggtctcgcatctgaacaac
tatgcctcccagcgggaagcggcaagcggcgctcacgcaggccttggacacattccctgg
gggagtgctttcggacatcacccgcacgtcgcgcaccccctgttgctgccccagaatggc
cacgggaacactggcaccacggcctcgcccacggaaccccaccaccagggcaggttggcc
acggcacatccggaggcgtcggctttgcgggcgccccctagcggcagccttggaccggtg
ctccccgtggtcacctccgcctccaaactctcgccgcctctgctctcctcggtggcctcc
ctgtcggccttccccttctcttttggctccttccacttactctctcccaatgcactgagc
ccttcggcacccacgcaggcagcaaaccttggcaaaccctatagaccttgggggacggag
attggagctttttaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010304
Entry
103010304         CDS       T03086                                 

Gene name
HEYL
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif-like
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04330  Notch signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103010304 (HEYL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103010304 (HEYL)
  09162 Cancer: specific types
   05224 Breast cancer
    103010304 (HEYL)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103010304 (HEYL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103010304 (HEYL)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103010304 (HEYL)
SSDB
Motif
Pfam: HLH Hairy_orange
Other DBs
NCBI-GeneID: 103010304
NCBI-ProteinID: XP_007164782
UniProt: A0A383YPL3
LinkDB
Position
Un
AA seq 357 aa
MSPRGEGERRRPHPRLPCASSRPGRPRPPGRGLCPPTAGLRGQPRPGRWSSEKSAFLFLS
SQMARPLSTPSPSQMQARKKRRGIIEKRRRDRINSSLSELRRLVPTAFEKQGSSKLEKAE
VLQMTVDHLKMLHATGGTGFFDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVR
IRLLSHLNSYAAEMEPSPTPAGPLAFPAWPWSFFHSCPGLSAPSSQLAILGRVPGPILPS
TSSLAYPIPAFRTTPLRRATGATLPARRNLLPSRGASSTRRARPLERPAAPLPPSGRAAR
GSHMAPLLRSSSPAPPGIVGSPAYVAVPGSSQGAAGRPAGAVLCHSWVSEITEVGAF
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgagcccccggggagaaggggagagaaggcgtccccacccacgcctgccctgtgcctct
tcccggcctgggagacctcggccgcctgggaggggtctgtgcccgcccacagccggcctc
cgaggtcagcccaggccagggagatggtcctctgaaaaatcagcctttcttttcctctcc
agccagatggcccggccgctgtccacccccagcccttcacaaatgcaagccaggaagaaa
cgcagagggatcatagagaaacggcgccgggaccgcatcaacagcagcctttctgaactg
cggcgcttggtccccactgcctttgagaagcagggctcctccaagctggagaaagccgag
gtcctgcagatgacggtagatcacttgaaaatgctccacgccactggcgggacaggattc
tttgatgctcgagccctggcagtcgacttccggagcatcggttttcgggagtgccttacc
gaggtcatcaggtacctgggggtcctggaagggcccagcagccgtgcagacccggtgcgg
attcgccttctctcccacctcaacagctatgcagccgagatggaaccttcacccacgccc
gctggccccctggcctttcctgcctggccctggtccttcttccatagctgtccagggcta
tcggcccccagcagccagctcgccatcctagggagagtgcccggccccatcctccccagc
acctcctctctggcttaccccatcccggccttcagaaccactcccttgcgcagagccact
ggcgccaccctgccagcccggaggaatttgctgcccagtcgaggggcatcttctacccgg
agggcccgccccctggagaggccagctgcacccctgccccccagtggcagggctgccagg
ggcagccacatggcacccctcctgcgatcttcttcccccgcccctcctggcattgtgggc
tctcctgcttatgtggctgttcctgggtcttcccagggggcagctgggaggccagcagga
gctgtgctctgccactcctgggtctctgaaatcactgaagttggggctttctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014703
Entry
103014703         CDS       T03086                                 

Gene name
HEY2
Definition
(RefSeq) hes related family bHLH transcription factor with YRPW motif 2
  KO
K09091  hairy and enhancer of split related with YRPW motif
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04330  Notch signaling pathway
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103014703 (HEY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014703 (HEY2)
  09162 Cancer: specific types
   05224 Breast cancer
    103014703 (HEY2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103014703 (HEY2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103014703 (HEY2)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    103014703 (HEY2)
SSDB
Motif
Pfam: HLH Hairy_orange dCache_2 HTH_Crp_2
Other DBs
NCBI-GeneID: 103014703
NCBI-ProteinID: XP_007190860
UniProt: A0A384ATZ2
LinkDB
Position
Un
AA seq 337 aa
MKRPCEETTSESDMDETIDVGSENNYSGQSTSSVIRSNSPTTTSQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCASQREAAAMTSSLAHHHHPL
HPHHWAAAFHHLPAALLQPGGLHASEPTPCRLSTTSEVPPAHGSTLLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNSKPYRPWGTEVGAF
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaagcgcccttgcgaggagacgacctctgagagcgacatggacgagaccatcgacgtg
gggagcgagaacaattactcgggacaaagtactagctctgtgattagatcaaattctcca
acaacgacatctcagattatggcaagaaagaaaaggagagggataatagagaaaaggcgt
cgagatcggataaataacagtttatctgagctgagacgactggtgccaaccgcttttgaa
aaacaaggatctgcaaagttagaaaaagctgaaatactgcaaatgacagtcgatcattta
aagatgctccaggcaactgggggtaaaggctactttgacgcccacgctcttgccatggac
ttcatgagcattggattccgagagtgcttaaccgaagtggcaaggtacctgagctctgtg
gaaggcctggactcctccgatccactgcgggtgcgcctggtctctcatctcagcacgtgt
gcctcacagcgagaggcggcggcaatgacctcgtctctggcccaccaccatcaccccctg
catccgcaccactgggcggcggccttccaccacctgccggcagccctgctccaacccggc
ggactccacgcctcggaacccacgccttgccgcctctccaccacttcagaagtgcctccc
gcccacggctccaccctcctcacggccacgtttgcccacgcagactctgcccttcggatg
ccgtcaacaggcagtgtcgccccctgtgtgccgcctctctccacttctctcttgtccctc
tcggccactgtccacgcggccgctgcagcagccacggcagctgcgcacagcttccctctg
tccttcgctggggcgttccccatgctccccccaaacgcagctgcagcagtggcagctgcc
acagccatcagccctcccttgtcggtatcagccacgtccagccctcagcagacaagcagt
ggaacaaacagtaaaccttaccgaccctgggggacagaagtgggagctttttaa

DBGET integrated database retrieval system