KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002026
Entry
103002026         CDS       T03086                                 

Gene name
AKT3
Definition
(RefSeq) AKT serine/threonine kinase 3
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002026 (AKT3)
   04012 ErbB signaling pathway
    103002026 (AKT3)
   04014 Ras signaling pathway
    103002026 (AKT3)
   04015 Rap1 signaling pathway
    103002026 (AKT3)
   04370 VEGF signaling pathway
    103002026 (AKT3)
   04371 Apelin signaling pathway
    103002026 (AKT3)
   04630 JAK-STAT signaling pathway
    103002026 (AKT3)
   04668 TNF signaling pathway
    103002026 (AKT3)
   04066 HIF-1 signaling pathway
    103002026 (AKT3)
   04068 FoxO signaling pathway
    103002026 (AKT3)
   04072 Phospholipase D signaling pathway
    103002026 (AKT3)
   04071 Sphingolipid signaling pathway
    103002026 (AKT3)
   04024 cAMP signaling pathway
    103002026 (AKT3)
   04022 cGMP-PKG signaling pathway
    103002026 (AKT3)
   04151 PI3K-Akt signaling pathway
    103002026 (AKT3)
   04152 AMPK signaling pathway
    103002026 (AKT3)
   04150 mTOR signaling pathway
    103002026 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103002026 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    103002026 (AKT3)
   04218 Cellular senescence
    103002026 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002026 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103002026 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103002026 (AKT3)
   04613 Neutrophil extracellular trap formation
    103002026 (AKT3)
   04620 Toll-like receptor signaling pathway
    103002026 (AKT3)
   04625 C-type lectin receptor signaling pathway
    103002026 (AKT3)
   04660 T cell receptor signaling pathway
    103002026 (AKT3)
   04662 B cell receptor signaling pathway
    103002026 (AKT3)
   04664 Fc epsilon RI signaling pathway
    103002026 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    103002026 (AKT3)
   04062 Chemokine signaling pathway
    103002026 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103002026 (AKT3)
   04922 Glucagon signaling pathway
    103002026 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    103002026 (AKT3)
   04920 Adipocytokine signaling pathway
    103002026 (AKT3)
   04929 GnRH secretion
    103002026 (AKT3)
   04915 Estrogen signaling pathway
    103002026 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    103002026 (AKT3)
   04917 Prolactin signaling pathway
    103002026 (AKT3)
   04926 Relaxin signaling pathway
    103002026 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    103002026 (AKT3)
   04919 Thyroid hormone signaling pathway
    103002026 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103002026 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103002026 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    103002026 (AKT3)
   04728 Dopaminergic synapse
    103002026 (AKT3)
   04722 Neurotrophin signaling pathway
    103002026 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103002026 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    103002026 (AKT3)
   04213 Longevity regulating pathway - multiple species
    103002026 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002026 (AKT3)
   05205 Proteoglycans in cancer
    103002026 (AKT3)
   05230 Central carbon metabolism in cancer
    103002026 (AKT3)
   05231 Choline metabolism in cancer
    103002026 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103002026 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103002026 (AKT3)
   05212 Pancreatic cancer
    103002026 (AKT3)
   05225 Hepatocellular carcinoma
    103002026 (AKT3)
   05226 Gastric cancer
    103002026 (AKT3)
   05214 Glioma
    103002026 (AKT3)
   05221 Acute myeloid leukemia
    103002026 (AKT3)
   05220 Chronic myeloid leukemia
    103002026 (AKT3)
   05218 Melanoma
    103002026 (AKT3)
   05211 Renal cell carcinoma
    103002026 (AKT3)
   05215 Prostate cancer
    103002026 (AKT3)
   05213 Endometrial cancer
    103002026 (AKT3)
   05224 Breast cancer
    103002026 (AKT3)
   05222 Small cell lung cancer
    103002026 (AKT3)
   05223 Non-small cell lung cancer
    103002026 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103002026 (AKT3)
   05017 Spinocerebellar ataxia
    103002026 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103002026 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103002026 (AKT3)
   04931 Insulin resistance
    103002026 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103002026 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103002026 (AKT3)
   05135 Yersinia infection
    103002026 (AKT3)
   05152 Tuberculosis
    103002026 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103002026 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    103002026 (AKT3)
   05161 Hepatitis B
    103002026 (AKT3)
   05160 Hepatitis C
    103002026 (AKT3)
   05164 Influenza A
    103002026 (AKT3)
   05162 Measles
    103002026 (AKT3)
   05168 Herpes simplex virus 1 infection
    103002026 (AKT3)
   05163 Human cytomegalovirus infection
    103002026 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103002026 (AKT3)
   05169 Epstein-Barr virus infection
    103002026 (AKT3)
   05165 Human papillomavirus infection
    103002026 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103002026 (AKT3)
   05142 Chagas disease
    103002026 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103002026 (AKT3)
   01524 Platinum drug resistance
    103002026 (AKT3)
   01522 Endocrine resistance
    103002026 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002026 (AKT3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103002026 (AKT3)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103002026 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 103002026
NCBI-ProteinID: XP_007182678
UniProt: A0A384A5S8
LinkDB
Position
Un
AA seq 431 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEERTMNDFDYLKLLGKGTFGKVILVREK
ASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYV
NGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKIT
DFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYN
QDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGV
NWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHF
PQFSYSASGRE
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatatttccttttgaagacagatggctcattcataggatataaagag
aaaccccaagatgtggatttaccttatcccctcaacaacttttcagtagcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttattatcagatgtctccagtggacc
actgttatagagagaacatttcatgtagacactccagaggaaaggacaatgaatgatttt
gactatttgaaactactaggtaaaggcacttttgggaaagttattttggttcgagagaaa
gcaagtggaaaatactatgctatgaagattctgaagaaagaagttattattgccaaggat
gaagtggcacacactttaactgaaagcagagtattaaagaacactagacatcccttttta
acatccttgaaatattccttccagacaaaagaccgtttgtgttttgtgatggaatatgtt
aatgggggagagctgtttttccatttgtcgagagagcgggtgttctctgaggaccgcaca
cgtttctatggtgcagaaattgtctctgccttggactatctacattccggaaagattgtg
taccgtgatctcaagttggagaatttgatgctggataaagatggccacataaaaattaca
gattttggactttgcaaagaagggatcacagatgcagccaccatgaagacgttctgtggt
acaccagagtatctggccccagaggtgttagaagataatgactatggccgagccgtggat
tggtggggccttggggttgtcatgtatgaaatgatgtgcgggagattacctttctataac
caggatcatgagaaactttttgaactaattctaatggaagacattaaatttcctcgaaca
ctctcttcagatgcaaaatcattgctttcagggctcttgataaaggatccaaataaacgc
cttggtggaggaccagatgatgcaaaagaaattatgagacacagtttcttttctggagta
aactggcaagatgtgtatgataaaaagcttgtacctccttttaagcctcaagtaacatct
gagacagacaccagatactttgatgaagaatttacagctcagactattacaataacacca
cctgaaaagtatgatgaggacggtatggattgcatggacaatgagaggcggccgcacttc
cctcagttctcctactccgcgagcgggcgagaatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004139
Entry
103004139         CDS       T03086                                 

Gene name
AKT2
Definition
(RefSeq) AKT serine/threonine kinase 2
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103004139 (AKT2)
   04012 ErbB signaling pathway
    103004139 (AKT2)
   04014 Ras signaling pathway
    103004139 (AKT2)
   04015 Rap1 signaling pathway
    103004139 (AKT2)
   04370 VEGF signaling pathway
    103004139 (AKT2)
   04371 Apelin signaling pathway
    103004139 (AKT2)
   04630 JAK-STAT signaling pathway
    103004139 (AKT2)
   04668 TNF signaling pathway
    103004139 (AKT2)
   04066 HIF-1 signaling pathway
    103004139 (AKT2)
   04068 FoxO signaling pathway
    103004139 (AKT2)
   04072 Phospholipase D signaling pathway
    103004139 (AKT2)
   04071 Sphingolipid signaling pathway
    103004139 (AKT2)
   04024 cAMP signaling pathway
    103004139 (AKT2)
   04022 cGMP-PKG signaling pathway
    103004139 (AKT2)
   04151 PI3K-Akt signaling pathway
    103004139 (AKT2)
   04152 AMPK signaling pathway
    103004139 (AKT2)
   04150 mTOR signaling pathway
    103004139 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103004139 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    103004139 (AKT2)
   04218 Cellular senescence
    103004139 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103004139 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    103004139 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103004139 (AKT2)
   04613 Neutrophil extracellular trap formation
    103004139 (AKT2)
   04620 Toll-like receptor signaling pathway
    103004139 (AKT2)
   04625 C-type lectin receptor signaling pathway
    103004139 (AKT2)
   04660 T cell receptor signaling pathway
    103004139 (AKT2)
   04662 B cell receptor signaling pathway
    103004139 (AKT2)
   04664 Fc epsilon RI signaling pathway
    103004139 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    103004139 (AKT2)
   04062 Chemokine signaling pathway
    103004139 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103004139 (AKT2)
   04922 Glucagon signaling pathway
    103004139 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    103004139 (AKT2)
   04920 Adipocytokine signaling pathway
    103004139 (AKT2)
   04929 GnRH secretion
    103004139 (AKT2)
   04915 Estrogen signaling pathway
    103004139 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    103004139 (AKT2)
   04917 Prolactin signaling pathway
    103004139 (AKT2)
   04926 Relaxin signaling pathway
    103004139 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    103004139 (AKT2)
   04919 Thyroid hormone signaling pathway
    103004139 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103004139 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103004139 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    103004139 (AKT2)
   04728 Dopaminergic synapse
    103004139 (AKT2)
   04722 Neurotrophin signaling pathway
    103004139 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103004139 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    103004139 (AKT2)
   04213 Longevity regulating pathway - multiple species
    103004139 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004139 (AKT2)
   05205 Proteoglycans in cancer
    103004139 (AKT2)
   05230 Central carbon metabolism in cancer
    103004139 (AKT2)
   05231 Choline metabolism in cancer
    103004139 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103004139 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103004139 (AKT2)
   05212 Pancreatic cancer
    103004139 (AKT2)
   05225 Hepatocellular carcinoma
    103004139 (AKT2)
   05226 Gastric cancer
    103004139 (AKT2)
   05214 Glioma
    103004139 (AKT2)
   05221 Acute myeloid leukemia
    103004139 (AKT2)
   05220 Chronic myeloid leukemia
    103004139 (AKT2)
   05218 Melanoma
    103004139 (AKT2)
   05211 Renal cell carcinoma
    103004139 (AKT2)
   05215 Prostate cancer
    103004139 (AKT2)
   05213 Endometrial cancer
    103004139 (AKT2)
   05224 Breast cancer
    103004139 (AKT2)
   05222 Small cell lung cancer
    103004139 (AKT2)
   05223 Non-small cell lung cancer
    103004139 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004139 (AKT2)
   05017 Spinocerebellar ataxia
    103004139 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103004139 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103004139 (AKT2)
   04931 Insulin resistance
    103004139 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103004139 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103004139 (AKT2)
   05135 Yersinia infection
    103004139 (AKT2)
   05152 Tuberculosis
    103004139 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103004139 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    103004139 (AKT2)
   05161 Hepatitis B
    103004139 (AKT2)
   05160 Hepatitis C
    103004139 (AKT2)
   05164 Influenza A
    103004139 (AKT2)
   05162 Measles
    103004139 (AKT2)
   05168 Herpes simplex virus 1 infection
    103004139 (AKT2)
   05163 Human cytomegalovirus infection
    103004139 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103004139 (AKT2)
   05169 Epstein-Barr virus infection
    103004139 (AKT2)
   05165 Human papillomavirus infection
    103004139 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103004139 (AKT2)
   05142 Chagas disease
    103004139 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103004139 (AKT2)
   01524 Platinum drug resistance
    103004139 (AKT2)
   01522 Endocrine resistance
    103004139 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103004139 (AKT2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103004139 (AKT2)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103004139 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 103004139
NCBI-ProteinID: XP_007180023
UniProt: A0A383ZY25
LinkDB
Position
Un
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLXXXXXSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMQAIQMVANSLKQRGPGEDPM
DYKCGSPSDSSAAEEMEVAASKARAKVTMNDFDYLKLLGKGTFGKVILVREKASGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGSLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgcggtgagtacatcaag
acctggcggccccggtacttcctnnnnnnnnnnnnnnnntccttcattggatataaggag
cggcccgaggcccctgaccagaccctgccccccttaaacaacttctctgtcgcagaatgc
cagctgatgaagaccgagagaccgcggcccaacaccttcgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccatgtagactctccggatgagagggaggagtggatg
caggccatccagatggtcgccaacagcctcaagcagcggggcccgggggaggaccccatg
gactacaagtgtggctctcccagcgactcctctgcagccgaggagatggaagtggcagct
agcaaggcgcgggccaaggtgaccatgaatgacttcgactatctcaagctcctgggcaag
ggcacctttggcaaagtcatcctggtgcgggagaaggccagcggccgctactacgccatg
aagatcctgcggaaggaggttatcatcgctaaggatgaagtcgcccacacggtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacggtggcgagctgttcttccac
ctgtcccgggaacgcgtcttcacggaggagcgggcccgcttctatggcgcggagatcgtg
tcagccctggagtacctgcactcgcgggacgtggtgtaccgggacatcaagctggaaaac
ctcatgctggacaaagacggccacatcaagatcactgacttcggcctgtgcaaagagggc
atcagtgacggggccaccatgaaaaccttctgtgggacccctgaatacctggcgcctgag
gtgctggaagacaatgactacggccgggcggtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaggagatccgcttcccgcgcacgctcagcccggaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggctcggcggggggcccagtgatgcc
aaggaggtcatggagcacaggttcttcctcagtatcaactggcaggacgtggtgcagaag
aagctcctgccacccttcaaacctcaggtcacatctgaggttgacacaaggtactttgac
gacgagttcaccgcccagtccatcacaatcacacccccggaccgctatgacagcctgggc
tcactcgaactggaccagcggacccacttcccccagttctcctattcggccagcatccga
gagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013147
Entry
103013147         CDS       T03086                                 

Gene name
AKT1
Definition
(RefSeq) AKT serine/threonine kinase 1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04210  Apoptosis
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04380  Osteoclast differentiation
bacu04510  Focal adhesion
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04620  Toll-like receptor signaling pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04725  Cholinergic synapse
bacu04728  Dopaminergic synapse
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04926  Relaxin signaling pathway
bacu04929  GnRH secretion
bacu04931  Insulin resistance
bacu04932  Non-alcoholic fatty liver disease
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04973  Carbohydrate digestion and absorption
bacu05010  Alzheimer disease
bacu05017  Spinocerebellar ataxia
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103013147 (AKT1)
   04012 ErbB signaling pathway
    103013147 (AKT1)
   04014 Ras signaling pathway
    103013147 (AKT1)
   04015 Rap1 signaling pathway
    103013147 (AKT1)
   04370 VEGF signaling pathway
    103013147 (AKT1)
   04371 Apelin signaling pathway
    103013147 (AKT1)
   04630 JAK-STAT signaling pathway
    103013147 (AKT1)
   04668 TNF signaling pathway
    103013147 (AKT1)
   04066 HIF-1 signaling pathway
    103013147 (AKT1)
   04068 FoxO signaling pathway
    103013147 (AKT1)
   04072 Phospholipase D signaling pathway
    103013147 (AKT1)
   04071 Sphingolipid signaling pathway
    103013147 (AKT1)
   04024 cAMP signaling pathway
    103013147 (AKT1)
   04022 cGMP-PKG signaling pathway
    103013147 (AKT1)
   04151 PI3K-Akt signaling pathway
    103013147 (AKT1)
   04152 AMPK signaling pathway
    103013147 (AKT1)
   04150 mTOR signaling pathway
    103013147 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103013147 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    103013147 (AKT1)
   04218 Cellular senescence
    103013147 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103013147 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103013147 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103013147 (AKT1)
   04613 Neutrophil extracellular trap formation
    103013147 (AKT1)
   04620 Toll-like receptor signaling pathway
    103013147 (AKT1)
   04625 C-type lectin receptor signaling pathway
    103013147 (AKT1)
   04660 T cell receptor signaling pathway
    103013147 (AKT1)
   04662 B cell receptor signaling pathway
    103013147 (AKT1)
   04664 Fc epsilon RI signaling pathway
    103013147 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    103013147 (AKT1)
   04062 Chemokine signaling pathway
    103013147 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103013147 (AKT1)
   04922 Glucagon signaling pathway
    103013147 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    103013147 (AKT1)
   04920 Adipocytokine signaling pathway
    103013147 (AKT1)
   04929 GnRH secretion
    103013147 (AKT1)
   04915 Estrogen signaling pathway
    103013147 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    103013147 (AKT1)
   04917 Prolactin signaling pathway
    103013147 (AKT1)
   04926 Relaxin signaling pathway
    103013147 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    103013147 (AKT1)
   04919 Thyroid hormone signaling pathway
    103013147 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103013147 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103013147 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    103013147 (AKT1)
   04728 Dopaminergic synapse
    103013147 (AKT1)
   04722 Neurotrophin signaling pathway
    103013147 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103013147 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    103013147 (AKT1)
   04213 Longevity regulating pathway - multiple species
    103013147 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103013147 (AKT1)
   05205 Proteoglycans in cancer
    103013147 (AKT1)
   05230 Central carbon metabolism in cancer
    103013147 (AKT1)
   05231 Choline metabolism in cancer
    103013147 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103013147 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103013147 (AKT1)
   05212 Pancreatic cancer
    103013147 (AKT1)
   05225 Hepatocellular carcinoma
    103013147 (AKT1)
   05226 Gastric cancer
    103013147 (AKT1)
   05214 Glioma
    103013147 (AKT1)
   05221 Acute myeloid leukemia
    103013147 (AKT1)
   05220 Chronic myeloid leukemia
    103013147 (AKT1)
   05218 Melanoma
    103013147 (AKT1)
   05211 Renal cell carcinoma
    103013147 (AKT1)
   05215 Prostate cancer
    103013147 (AKT1)
   05213 Endometrial cancer
    103013147 (AKT1)
   05224 Breast cancer
    103013147 (AKT1)
   05222 Small cell lung cancer
    103013147 (AKT1)
   05223 Non-small cell lung cancer
    103013147 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103013147 (AKT1)
   05017 Spinocerebellar ataxia
    103013147 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103013147 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103013147 (AKT1)
   04931 Insulin resistance
    103013147 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103013147 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103013147 (AKT1)
   05135 Yersinia infection
    103013147 (AKT1)
   05152 Tuberculosis
    103013147 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103013147 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    103013147 (AKT1)
   05161 Hepatitis B
    103013147 (AKT1)
   05160 Hepatitis C
    103013147 (AKT1)
   05164 Influenza A
    103013147 (AKT1)
   05162 Measles
    103013147 (AKT1)
   05168 Herpes simplex virus 1 infection
    103013147 (AKT1)
   05163 Human cytomegalovirus infection
    103013147 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103013147 (AKT1)
   05169 Epstein-Barr virus infection
    103013147 (AKT1)
   05165 Human papillomavirus infection
    103013147 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103013147 (AKT1)
   05142 Chagas disease
    103013147 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103013147 (AKT1)
   01524 Platinum drug resistance
    103013147 (AKT1)
   01522 Endocrine resistance
    103013147 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103013147 (AKT1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103013147 (AKT1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   103013147 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 103013147
NCBI-ProteinID: XP_007176312
UniProt: A0A383ZMJ0
LinkDB
Position
Un
AA seq 476 aa
MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVEQRESPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADWLKRQEEEMMDF
RSGSPGENSGAEEMEVALAKPKQHVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKGEAPAQLEGRVPALLPSQALKYSFQTHDRLCFVMEYANGGELFFHLSRERV
FPEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGA
TMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILME
EIRFPRTLSPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFASILWQDVYEKKLNPP
FKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMEGVDSERRPHFPQFSYSASGTA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaacgacgtggccatcgtgaaggagggctggctgcacaaacgaggtgagtacatcaaa
acctggcggccccggtacttcctcttgaagaatgacggcaccttcatcggctacaaggag
cggccgcaggacgtggagcagcgtgagtcgcccctgaacaacttctccgtggcgcaatgc
cagctgatgaagacggagcggccgcggcccaacaccttcatcatacgctgcctgcagtgg
accacggtcatcgagcgcacgttccatgtagagacccctgaggagcgggaggagtggaca
actgccatccagacggtggccgactggctcaagaggcaggaggaggagatgatggacttc
cggtcaggctcgcccggcgagaactcaggggccgaggagatggaggtggcgctggccaag
cccaagcagcacgtgaccatgaatgagtttgagtacctgaagctgctgggcaaaggcacc
ttcgggaaggtgatcctggtgaaggagaaggccacgggccgctactatgccatgaagatc
ctgaagaaggaggttattgtggccaagggcgaagctcctgcccagctggagggccgggtt
ccagctctgcttccctcgcaggccctgaagtactccttccagacccacgaccgcctgtgc
ttcgtcatggagtacgccaacggaggcgagctcttcttccacctgtcccgggagcgggtg
ttccccgaggaccgggcccggttctacggcgccgagatcgtgtccgccctggactacctg
cactcggagaagaacgtggtgtaccgggacctcaagctggagaacctcatgctggacaag
gacgggcacatcaagatcaccgacttcgggctgtgcaaggagggcatcaaggatggcgcc
accatgaagaccttctgcgggacgcccgagtacctggcccccgaggtgctggaagacaat
gactacggccgggcggtggactggtgggggctgggcgtggtcatgtacgagatgatgtgc
ggccgcctgcccttctacaaccaggaccacgagaagctcttcgagctcatcctcatggag
gagatccgcttcccacgcacgctcagccctgaggccaagtccctgctctcagggctgctc
aagaaggaccccaagcagcggctgggtgggggctccgaggacgccaaggagatcatgcag
caccgcttcttcgccagcatcttgtggcaggatgtgtatgagaagaagctcaacccgccc
ttcaagcctcaggtcacgtccgagacggacaccaggtattttgatgaggagttcacagcc
cagatgatcaccatcacgccgcccgaccaagatgacagcatggagggcgtggacagcgaa
cggaggcctcacttcccccagttctcctactcggccagcggcacggcctga

DBGET integrated database retrieval system