KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002083
Entry
103002083         CDS       T03086                                 

Gene name
VAV2
Definition
(RefSeq) vav guanine nucleotide exchange factor 2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04810  Regulation of actin cytoskeleton
bacu05135  Yersinia infection
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103002083 (VAV2)
   04024 cAMP signaling pathway
    103002083 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002083 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103002083 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103002083 (VAV2)
   04660 T cell receptor signaling pathway
    103002083 (VAV2)
   04662 B cell receptor signaling pathway
    103002083 (VAV2)
   04664 Fc epsilon RI signaling pathway
    103002083 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    103002083 (VAV2)
   04670 Leukocyte transendothelial migration
    103002083 (VAV2)
   04062 Chemokine signaling pathway
    103002083 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103002083 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103002083 (VAV2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103002083 (VAV2)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103002083 (VAV2)
SSDB
Motif
Pfam: RhoGEF SH3_2 SH3_1 SH3_9 SH2 C1_1 PH CH CAMSAP_CH SH2_2 PH_10 C1_2 Zn_ribbon_17
Other DBs
NCBI-GeneID: 103002083
NCBI-ProteinID: XP_007194477
UniProt: A0A384B4C5
LinkDB
Position
Un
AA seq 824 aa
MARASGMAVVSPPSREALVQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKV
ISAVSRLSLHNLAQNKGIRPFPSEETAENDDDVYRSLEELADEHDVGEDIYDCVPCEDEG
DDIYEDIIKVEVQQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMTPL
RLVLSPADMAAIFINLEDLIKVHHSFLRAIDVSMMAGGSTLAKVFLDFKERLLIYGEYCS
RMEHAQNTLNQLLASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLS
HSTDRPERQQLKEALEAMQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKI
DGELKVRSIVNHTKQDRYLFLFDKVVIVCKRRGYSYELKEIIELLFHKMTDDPMNNKDVK
KSHGKMWSYGFYLIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQM
YTFDKTTNCKACRMFLRGTFYQGYLCTKCGVGAHKECLEVTPPCKISSPADLDTSGAGPG
PKMVAVQNYHGNPAPPGKPVLTFQTGDVIELLRGDPESQWWEGRLVQTRKSGYFPSSSVK
PCPVDGRPPISRPPSRDMDYAAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFA
ISIKFNDEVKHIKVVEKDSWVHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYK
SRERVASRASSRSPASCASYSFSFLSPQGSSAPFWSAVFTPRVIGTAVARYNFAARDLRE
LSLREGDVVKIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2475 nt   +upstreamnt  +downstreamnt
atggccagggccagtgggatggccgtggtgtctcctccgagcagggaagcgctggtccag
ttcctgtgtttgaagaacatccgcaccttccttaaagtctgccacgacaaatttggactg
aggaacagcgagctgtttgaccccttcgacctcttcgatgtccgagactttgggaaggtc
atctcggctgtgtcgagactctccctgcacaacttggctcagaacaaagggatcaggccc
ttcccctcggaggagaccgcggagaatgacgacgatgtctaccgcagcctggaggaactt
gcagacgagcatgacgtgggggaggacatctacgactgcgtcccgtgcgaggatgaaggg
gatgacatttatgaggacatcatcaaggtggaggtgcagcagcccatgattagatacatg
cagaaaatgggcatgacggaggacgacaagagaaactgctgcctgctggagatccaggag
acggaagccaagtactaccggaccctggaggacatcgagaagaactacatgacccctctg
aggctggtgctgagcccggcggacatggcggccatcttcatcaacctggaggacctaatc
aaggtgcatcacagcttcctgagggccatcgacgtgtccatgatggcggggggcagcacg
ctggccaaggtcttcctggacttcaaggaaaggctcctgatctatggggagtactgcagc
cgcatggagcacgcccagaacacgctgaaccagctcctcgccagcagggaggacttcaga
cagaaagtcgaggaatgcaccctgaaggtccaagacgggaagtttaagctgcaggacctg
ctggtggtccccatgcagagggtgctcaaataccacctgctcctcaaggaacttctgagc
cattccaccgacaggcccgagaggcagcagctcaaagaagcgctggaggccatgcaggac
ctggcaatgtacataaacgaagttaaacgggacaaagagaccctgaagaaaatcagcgaa
tttcagagttctatagaaaacttgcaagtgaaactggaggaatttgggagaccaaagatc
gatggggaactgaaggtccggtccatagtcaaccacaccaagcaagacaggtacctgttc
ctgtttgacaaggtggtcattgtctgcaagaggaggggctacagctacgagctgaaggag
atcatcgagctgcttttccacaagatgaccgacgaccccatgaacaacaaggatgtcaag
aagtctcacgggaaaatgtggtcctacggcttctatctaattcaccttcaaggcaagcag
ggcttccagtttttctgcaagacggaagacatgaagaggaagtggatggaacagtttgag
atggccatgtcaaacatcaagccagacaaagccaacgccaaccaccacagcttccagatg
tacacgtttgataagaccaccaactgcaaagcctgtaggatgttcctcagaggcaccttc
taccagggttacctgtgcaccaagtgtggcgtcggggcgcacaaggagtgtctggaggtg
acccctccctgcaagatcagttctcctgcggacctggacacctctggagcggggccaggt
cccaagatggtggccgtgcagaattaccatggcaaccctgctccccccgggaagccggtg
ctgaccttccagacgggcgatgtgattgagctactgagaggcgaccctgagtctcagtgg
tgggagggtcggttggtgcaaaccaggaagtcaggttacttccctagctcgtctgtgaag
ccctgtccagtggatggaaggccgcccatcagccggccaccgtcccgggatatggactac
gccgcatacccctggtttgccggcaacatggaaaggcagcagaccgacaacctgctcaaa
tcccacgccagcgggacctacctaatcagggagcggccggccgaggccgagcgctttgcc
ataagcatcaaattcaatgacgaggtgaagcacattaaggtggtggagaaggacagctgg
gtgcacatcacagaagccaagaaatttgaaagcctcttggagttggtagagtactaccag
tgccactcgctcaaggagagcttcaagcagctggacaccacgctcaagtacccctacaag
tcacgggaacgcgtggcctctagggcctccagccggtccccagcttcctgcgcttcctac
agcttttcttttctcagtcctcagggctcctccgcgcccttctggtcagcagtgttcacg
ccccgcgtcatcggcacggccgtggccaggtacaacttcgctgcccgggacctgcgggag
ctctcgctgcgagaaggcgacgtggtgaagatctacagccgcatcggtggggaccagggc
tggtggaagggcgagaccaacggccggattggctggtttccttcaacgtacgtagaagaa
gagggcatccagtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103018979
Entry
103018979         CDS       T03086                                 

Gene name
VAV1
Definition
(RefSeq) vav guanine nucleotide exchange factor 1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04810  Regulation of actin cytoskeleton
bacu05135  Yersinia infection
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103018979 (VAV1)
   04024 cAMP signaling pathway
    103018979 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103018979 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103018979 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103018979 (VAV1)
   04660 T cell receptor signaling pathway
    103018979 (VAV1)
   04662 B cell receptor signaling pathway
    103018979 (VAV1)
   04664 Fc epsilon RI signaling pathway
    103018979 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    103018979 (VAV1)
   04670 Leukocyte transendothelial migration
    103018979 (VAV1)
   04062 Chemokine signaling pathway
    103018979 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103018979 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103018979 (VAV1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103018979 (VAV1)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103018979 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH3_9 SH2 C1_1 PH CDC24 C1_2 LZ3wCH PH_16
Other DBs
NCBI-GeneID: 103018979
NCBI-ProteinID: XP_007169141
UniProt: A0A383Z243
LinkDB
Position
Un
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCYEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEVYEDLMRT
EPVPMQPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDVEIIFINI
EDLLRVHTHFLKEMKEALANPSAPTLYQVFIKYKERFLIYGRYCSQVESATKHLDRVATA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDATEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDTYDLKDFVNLHSFQVRDDSSGERDNKKWTHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCQRCRAPAHKECLGRVPPCGRHGQDFSGTMKKDKPHRRAQDKKRNELGLPKMEVC
QEYYGLPPPPGAIGPFLRLSPGDIVELTKAEAEQNWWEGRNTSTNEVGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAAAESILTNRSDGTFLVRQRVKDAAEFAISIKXXXEEKHIKI
MTAEGLYRITEKKAFRGLMELVEFYQQNSLKDCFKSLDTTLQFPFKEPERRAISKPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPSNYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagttgtggcgccagtgcacccactggctgatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggatggggcccaggtgtgcgagctggcgcaggccctccgggatggc
gtcctcctgtgccagttgctcaacaacctgctgccccacgccatcaacctgcgagaggtc
aacctgcgtccccagatgtcccagttcctgtgcctcaagaatatccgcaccttcctgtct
acctgctatgagaagttcggcctcaagcggagtgagctctttgaggcctttgacctcttt
gatgtgcaggatttcgggaaggtcatctacactctgtccgctctgtcctggacgccaatt
gcccagaacaaggggatcatgcctttccccactgaggaggagagtgtgggggatgaggac
atctacagtggcctgtccgaccagatcgacgacacggtggaggaggatgaggacctgtac
gactgcgtggagaacgaggaggccgagggcgacgaggtgtacgaggacctcatgcgcacg
gagccggtgcccatgcagcccaagatgacagagtatgacaagcggtgctgctgtctgcgg
gagatccagcagacggaagagaagtacacggacacgctgggctccatccaacagcatttt
atgaagcccttgcagcggttccttaaacctcaagacgttgagatcatcttcatcaacatc
gaggacctgcttcgtgtgcacacccacttcctaaaggagatgaaggaagccctggccaac
cccagtgcacccaccctctaccaggtcttcatcaaatacaaggagaggttcctcatctat
ggccgctactgcagccaggtggagtcagccaccaagcacctggaccgtgtggctacagcc
cgggaggatgtgcagatgaagctggaggaatgttctcagcgagcgaacaacgggaggttc
accttacgggacctgttgatggtgcccatgcagcgggtcctcaaatatcacctccttctc
caggagctggtgaaacacacgcaggacgcaacggagaaggagaacttgcggctggccctg
gatgccatgagggacctggcacagtgcgtgaacgaggtcaagcgggacaacgagacgctg
aggcagatcaccaacttccagctgtccattgagaacctggaccagtctctggcccactat
ggccgacccaagatcgatggcgagctcaagatcacttctgtggagcggcgctccaagatg
gacaggtacgccttcctgctcgacaaagctctgctcatctgtaagcgccgaggggacacc
tacgacctcaaggactttgtgaacctgcacagcttccaggttagagatgactcctccgga
gagcgggacaacaagaagtggacccacatgttcctcctgattgaggaccaaggtgcccag
ggctatgagctgtttttcaagacacgagaactgaagaagaagtggatggagcagttcgag
atggccatctccaacatctaccccgagaacgccactgccaacgggcatgacttccagatg
ttttcctttgaggagaccacgtcctgcaaggcttgccagatgctgctgagaggcactttc
tatcagggctaccgttgtcagaggtgccgggcacctgcacacaaggagtgtctggggagg
gtccctccatgtggtcgacacgggcaagatttttcaggaactatgaagaaggataagcca
catcggcgggctcaagacaaaaagaggaatgagctgggcctgcccaagatggaggtgtgc
caggagtactatgggctgcctccaccccctggagccattggaccttttctacgcctcagc
cctggagacattgtggaactcaccaaggccgaagctgaacagaactggtgggagggcagg
aatacgtccaccaatgaagttggctggtttccctgtaacagggtcaagccctacgtgcac
ggtccccctcaggacctgtctgttcatctctggtacgcgggccccatggagcgagctgcg
gcagaaagcatcctcaccaaccgctcggacgggacgtttttggtgcgacagagggtgaaa
gatgctgcagaatttgccatcagcattaagnnnnnnnntgaggaaaagcatattaaaatc
atgacagcagaaggactgtaccggattacagagaagaaggctttccgggggcttatggag
ctggtagaattctaccaacagaattctctgaaggattgcttcaagtcactggacaccacc
ctgcagttccctttcaaggagcctgagaggagagccatcagcaaaccaccagcagggagc
accaagtattttggcacagccaaagcccgctatgacttctgcgcccgggaccgatcggag
ctgtctctcaaagagggtgacatcatcaagatccttaacaagaaggggcagcagggctgg
tggcgaggggagatctatggccgggttggctggttcccctccaactatgtggaagaggat
tattctgagtactgctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019070
Entry
103019070         CDS       T03086                                 

Gene name
VAV3
Definition
(RefSeq) vav guanine nucleotide exchange factor 3
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04810  Regulation of actin cytoskeleton
bacu05135  Yersinia infection
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103019070 (VAV3)
   04024 cAMP signaling pathway
    103019070 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103019070 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103019070 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103019070 (VAV3)
   04660 T cell receptor signaling pathway
    103019070 (VAV3)
   04662 B cell receptor signaling pathway
    103019070 (VAV3)
   04664 Fc epsilon RI signaling pathway
    103019070 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    103019070 (VAV3)
   04670 Leukocyte transendothelial migration
    103019070 (VAV3)
   04062 Chemokine signaling pathway
    103019070 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103019070 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103019070 (VAV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:bacu04990]
    103019070 (VAV3)
Domain-containing proteins not elsewhere classified [BR:bacu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   103019070 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 Filamin PH_10 Prok-RING_1 PH_16 LZ3wCH C1_2 Zn_ribbon_17 IQ_SEC7_PH
Other DBs
NCBI-GeneID: 103019070
NCBI-ProteinID: XP_007169556
UniProt: A0A383Z3A4
LinkDB
Position
Un
AA seq 847 aa
MEPWKQCALWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPV
ALATGIRPFPTEESVNDDDIYKGLPDLIDETRVEDEEGLYDCVYGEDEGGEVYEDLMKAE
EVHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIHDSIVNKNDQNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPVEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHIQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFNRVTSCKVCQMLLRGTFYQ
GYLCVKCGARAHKECLGRVDNCGRVNSAEQGTLKPSEKRTNGLRRTPRQVDPGLPKMQAI
RNYTGMPAPALHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLTSGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSTGQRGNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgcgctgtggctcatccactgcaaggtgctgcccgccaac
caccgggtgacctgggactcggcgcaggtgttcgacctggctcagaccctccgcgatgga
gtcctgctctgccagctgctcaacaacctccgcgcgcactccatcaacctgaaggagatc
aacctgaggccgcagatgtcccagtttctctgtttgaagaacataaggacattcctcacg
gcctgttgcgagacgtttggaatgagaaagagtgaactctttgaggcgtttgacttgttt
gatgtccgtgactttggaaaggttatagaaacattatcgcgactctctcgcacacctgta
gcgctggccacaggaatcaggcccttcccgacagaagaaagcgttaatgatgacgacatc
tacaaaggcctgcctgatttaatagatgaaacccgtgtggaagatgaagagggtctgtac
gactgtgtttatggggaagacgaaggtggcgaagtgtacgaggacttgatgaaggcagag
gaggtgcatcagcctaaatgtccagaaaatgacatacgaagttgctgcctagcagaaatc
aagcagacagaagaaaaatatacagaaacattggagtcaatagaaaaatatttcatggca
ccattaaaaagatttctgacagcagccgaatttgattcagtattcatcaacattcctgaa
cttgtaaaagttcatcggaacctaatgcaagagattcatgattccattgtaaataaaaac
gaccagaacttgtatcaagttttcattaactacaaggaaaggttggttatttatgggcag
tactgcagtggagtggagtcggccatctctagtctagactacatttctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttctaaaagagcaaataatgggaaatttactctt
cgagatttgcttgtggtccctatgcagcgtgttttaaagtatcaccttctccttcaggag
ctggtcaaacataccactgatcctgtggagaaggcaaatttgaaactggctcttgatgca
atgaaggacttggcacagtatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagaaaatttgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgaataaccactctagacaagcatacgaaacaagaaagg
catatcttcttatttgatttggcagtgattgtatgtaaaaggaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaaaatagccaacaatcctacaactgataaa
gaaaataaaaagtggtcttatggcttctacctcatccatatccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaaaaagtggctggaacagtttgaaatggct
ttgtccaacataaggccagactatgcagactccaatttccatgagttcaagatgcacacc
ttcaaccgggttacatcctgcaaagtctgccagatgctcctgaggggaacattttatcaa
ggctatttatgtgttaagtgtggtgcaagagcacacaaagaatgtttgggaagagtagac
aattgcggcagagttaattctgctgaacaagggacgctcaaaccatcggagaaacggacc
aatggactccgaagaacccccagacaggtggatccaggtttaccaaagatgcaggccatt
aggaactatactggaatgccagcccccgctcttcatgaaggacccccgttacacatccag
gcaggggatacagttgaacttctgagaggagatgcacacagtctgttttggcagggtaga
aatttaacatctggagaggttggattttttccgagtgatgctgtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caggcagagactgaacttattaacagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaagtttaaaagcttaatg
gaacttgtggagtactacaagcatcactctcttaaagaagggttcagaaccttggataca
actctgcagtttccatacaaggagccagaacattccactggacagaggggtaatagagca
ggcaacagcttgttaagtccaaaggtgctgggcatcgccatcgctcggtatgacttctgt
gcaagagatatgcgagaattgtccttgttgaaaggagatgtggtgaagatttacacgaag
atgagtgcgaatggctggtggagaggagaagtaaatggcagggtgggctggtttccatcc
acgtatgtggaagaggatgaataa

DBGET integrated database retrieval system