KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002086
Entry
103002086         CDS       T03086                                 

Gene name
MET
Definition
(RefSeq) MET proto-oncogene, receptor tyrosine kinase
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04360  Axon guidance
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu05100  Bacterial invasion of epithelial cells
bacu05144  Malaria
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05211  Renal cell carcinoma
bacu05218  Melanoma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002086 (MET)
   04014 Ras signaling pathway
    103002086 (MET)
   04015 Rap1 signaling pathway
    103002086 (MET)
   04020 Calcium signaling pathway
    103002086 (MET)
   04151 PI3K-Akt signaling pathway
    103002086 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002086 (MET)
   04520 Adherens junction
    103002086 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103002086 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002086 (MET)
   05202 Transcriptional misregulation in cancer
    103002086 (MET)
   05206 MicroRNAs in cancer
    103002086 (MET)
   05205 Proteoglycans in cancer
    103002086 (MET)
   05230 Central carbon metabolism in cancer
    103002086 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103002086 (MET)
   05226 Gastric cancer
    103002086 (MET)
   05218 Melanoma
    103002086 (MET)
   05211 Renal cell carcinoma
    103002086 (MET)
   05223 Non-small cell lung cancer
    103002086 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    103002086 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    103002086 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103002086 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002086 (MET)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103002086 (MET)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  MET family
   103002086 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal Linker_histone Ninjurin
Other DBs
NCBI-GeneID: 103002086
NCBI-ProteinID: XP_007195180
UniProt: A0A384B696
LinkDB
Position
Un
AA seq 1382 aa
MKAPAVLAPGILVLLFTLVQKSNGECKEALVKSKMNLNMQYQLPNFTAETPIQNVVSHKH
HIYLGAINYLYVLNDKDLQKVAEYKTGPVLEHPDCFPCQNCSHKANLSGGVWKDNINMAL
LVDTYYDDQLISCGSVHRGTCQRHVLPPDSTANIQSEVHCMYSPQADEEPSQCPDCVVSA
LGTKVLLSEKDRFINFFVGNTINSSYLPDHSLHSISVRRLKETQDGFKFLTDQSYIDVLP
EFRDSYPIKYVHAFESNHFIYFLTVQRETLDAQTFHTRIIRFCSVDSGLHSYMEMPLECI
LTEKRRKRSTREEVFNILQAAYVSKPGTQLAKQIGANLNDDILYGVFAQSKPDSVEPMNR
SAVCAFPVKYVNEFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEVRSDEYRTE
FTTALQRVDLFMGQFNQVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGSLTPHVNF
RLDSHPVSPEAIVVHPLNQNGYTLVVTGKKITKIPLNGLGCEHFQSCGQCLAAPSFVQCG
WCHDECVRSEECAGGTWTQETCLPTIYKVFPTSAPLEGGTTLTICGWDFGFKRNNKFDLK
KTKVLLGNESCTLTLSESTINMLKCTVGPAMNEHFNMSIVISNSRGTVHYSTFSYVDPII
KSISPSYGPKTGGTLLTLTGKHLNSGNSRHISIGGKTCTLKSVSDSILECYTPAQSTPTE
FPIKLKIDLANREMNSFIYREDPIVYEIHPTKSFVSGGSTITGVGKNLNSVSILRMVINV
HEAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGIHSKYFDLIYVHNP
VFKPFEKPVMISIGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHSHSEAVLCTVPND
LLKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIVGVVSISIILLLLLGLFLWLKKRK
QIKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNG
SCRQVQYPLTDLSPILTSGDSDISSPLLQNAVHIDLSALNPELVQAVQHVVIGPSSLIVH
FNEVIGRGHFGCVYHGTLLDNDDKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNV
LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKK
FVHRDLAARNCMLDEKFTVKVADFGLARDVYDKEYYSVHNKTGAKLPVKWMALESLQTQK
FTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKC
WHPKAELRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSQDNVDGEG
DT
NT seq 4149 nt   +upstreamnt  +downstreamnt
atgaaggcccctgctgtgcttgcacctggcatccttgtgcttctgtttaccttggtgcag
aagagcaatggggagtgtaaagaggcactagtaaagtccaagatgaatttgaacatgcag
tatcagcttcctaacttcacagcagaaacacccattcagaatgtcgtttcgcacaagcat
cacatttacctcggtgccattaactacctttacgttttaaatgacaaagaccttcagaag
gttgctgagtacaagactgggcctgtgctggaacacccagattgtttcccatgtcagaac
tgcagccacaaagccaatttatcaggtggcgtttggaaagataacatcaacatggctctg
cttgttgacacgtactatgatgaccaactcattagctgcggcagtgtccacagagggacc
tgccagcgacacgtccttccacctgacagtactgctaacatacagtcggaggttcattgc
atgtactctccacaggcagacgaagagcccagccaatgtcctgactgtgtggtgagtgcc
ctgggaaccaaagtcctgctgtctgagaaggatcgattcatcaacttcttcgtgggcaat
accataaattcttcttaccttccagatcattcattgcattcgatatctgtgagaaggcta
aaggaaacgcaagatggttttaagtttttgacagaccaatcctatattgatgttctacct
gagttccgagattcctaccccattaagtatgtccacgcctttgaaagcaaccattttatt
tactttttgacggtccaacgggaaactctagatgctcagacttttcacacaagaataatc
aggttctgttcagtagactctggtttgcattcgtacatggaaatgcctctggagtgtatt
ctcacagaaaagagaagaaagagatccacaagggaggaagtgtttaatattctccaagct
gcgtatgtcagtaagcctgggacccagctcgctaagcaaataggtgccaacctgaatgat
gacattctctacggggtgtttgcacaaagcaagccagattctgtcgaaccaatgaatcgc
tctgctgtctgtgcgttccctgtcaaatatgtcaatgaattcttcaacaagattgtcaac
aaaaacaatgtgagatgtctccagcatttttatggccccaaccacgaacactgcttcaat
aggacacttctgagaaattcatcaggctgcgaagtgcgcagtgatgaataccgaacggag
tttaccacagctttgcagcgcgttgacttattcatgggccagttcaaccaagtcctctta
acatctatatccacctttattaaaggagacctcaccatcgctaatcttggaacatcagag
ggtcgattcatgcaggttgtggtttctcgatcaggatcattaaccccacacgtgaatttt
cgcctggattcccaccctgtgtctccagaagcaattgtggtgcacccgctaaaccaaaat
ggctatacactcgttgtcactgggaagaagatcaccaagatcccgctgaatggcttgggc
tgtgaacatttccagtcctgcggtcagtgcctcgccgccccttcctttgtgcagtgtggc
tggtgccatgatgaatgtgtgcgatcggaggagtgcgctggtggaacatggactcaagag
acctgtctgcctacaatctacaaggttttcccaactagtgccccccttgaaggagggaca
acgctgaccatatgtggctgggactttggattcaagaggaataataaatttgacttgaag
aaaaccaaagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgata
aacatgttgaaatgcacagttggtcctgcaatgaatgaacatttcaatatgtccatagtt
atttcaaacagtcgagggaccgtacattatagtacattttcctatgtggatcctataata
aaaagtatttctccaagttatggtcctaaaactggtggcactttacttacattaactgga
aagcacctaaacagtggaaattctagacacatttcaattggtggaaaaacatgtacttta
aaaagtgtttcagatagtattctcgaatgttataccccagcccaaagcactccaactgag
tttcctattaaattgaaaattgacttagccaaccgagagatgaacagcttcatttaccgg
gaagaccccattgtctatgaaatacatcccaccaaatcttttgttagtggtgggagcaca
ataacaggtgttggaaaaaacctgaattcagttagtatcctgaggatggtaataaatgtg
cacgaagcgggaaggaactttacagtggcatgtcagcatcgctctaattcggagataatc
tgctgtacaactccttcactacaacagctgaacctacaactccccctgaaaaccaaagcc
tttttcatgttagatgggatccattccaaatactttgatctcatttatgtacataatcct
gtgtttaagccttttgaaaagccagtgatgatctcaataggcaatgaaaatgtactggaa
atcaagggaaacgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaat
aagagctgtgagaatatacactcacattctgaagccgttttatgtacggtccccaatgac
ctgctgaaattgaacagcgaactaaacatagagtggaagcaagcaatttcttcaaccgtc
cttggaaaagtgatagttcaaccagatcagaatttcacaggactgattgttggtgttgtc
tcaatatcaataatactcttattattacttgggctgttcctgtggctgaaaaagagaaag
caaattaaagatctgggcagtgaattagttcgctatgatgcaagggtacacactcctcat
ttggatcggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaa
tctgtagactacagagctacttttccagaagaccagtttcctaactcatctcagaatggg
tcatgcagacaagtgcagtatcctctgacagacctatcccccatcctaactagtggggac
tctgatatatccagtccattactgcaaaatgctgtccacattgacctcagtgctctaaat
ccagagctggtccaggcagttcagcatgtagtgattgggccaagtagcctgattgtgcat
ttcaatgaagtcataggaagaggacattttgggtgtgtatatcatgggactttgttggac
aacgatgataagaaaattcactgtgctgtgaaatccttgaatagaatcactgacatagga
gaagtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtt
ctctcgctcttgggaatctgccttcgaagtgaggggtctccactggtggtcctaccgtac
atgaaacatggggatcttcgaaatttcattagaaatgagactcacaaccccactgtaaaa
gatcttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaag
tttgtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcactgtcaaa
gttgctgattttggccttgccagagacgtgtatgataaggaatactatagcgtacacaac
aaaacaggtgcaaaactgccggtgaagtggatggctttagaaagcctgcaaactcagaaa
tttaccaccaagtcagatgtgtggtcctttggcgtgctcctctgggaactgatgacaaga
ggagcaccaccttatcctgatgtcaacacctttgatatcacagtatatttgttgcaaggc
agaaggctcctacaacctgaatactgcccagatcccttgtatgaagtgatgctgaaatgc
tggcaccctaaagctgaactgcgcccatccttttctgaactggtctccaggatatcagcg
atattctctactttcattggggagcactatgtccacgtgaacgctacatacgtgaatgtc
aaatgtgtcgctccatatccttctctgttgtcatcacaagataatgttgatggcgagggg
gacacatga

DBGET integrated database retrieval system