KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002153
Entry
103002153         CDS       T03086                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8-like
  KO
K06856  immunoglobulin heavy chain
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04613  Neutrophil extracellular trap formation
bacu04640  Hematopoietic cell lineage
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04672  Intestinal immune network for IgA production
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05150  Staphylococcus aureus infection
bacu05152  Tuberculosis
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05202  Transcriptional misregulation in cancer
bacu05310  Asthma
bacu05320  Autoimmune thyroid disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05340  Primary immunodeficiency
bacu05414  Dilated cardiomyopathy
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103002153
   04020 Calcium signaling pathway
    103002153
   04072 Phospholipase D signaling pathway
    103002153
   04151 PI3K-Akt signaling pathway
    103002153
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103002153
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103002153
   04613 Neutrophil extracellular trap formation
    103002153
   04650 Natural killer cell mediated cytotoxicity
    103002153
   04662 B cell receptor signaling pathway
    103002153
   04664 Fc epsilon RI signaling pathway
    103002153
   04666 Fc gamma R-mediated phagocytosis
    103002153
   04672 Intestinal immune network for IgA production
    103002153
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103002153
  09163 Immune disease
   05310 Asthma
    103002153
   05322 Systemic lupus erythematosus
    103002153
   05323 Rheumatoid arthritis
    103002153
   05320 Autoimmune thyroid disease
    103002153
   05330 Allograft rejection
    103002153
   05340 Primary immunodeficiency
    103002153
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103002153
   05416 Viral myocarditis
    103002153
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103002153
   05150 Staphylococcus aureus infection
    103002153
   05152 Tuberculosis
    103002153
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103002153
   05169 Epstein-Barr virus infection
    103002153
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103002153
   05140 Leishmaniasis
    103002153
   05143 African trypanosomiasis
    103002153
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103002153
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103002153
SSDB
Motif
Pfam: V-set Ig_3 ig I-set
Other DBs
NCBI-GeneID: 103002153
NCBI-ProteinID: XP_007188811
LinkDB
Position
Un
AA seq 122 aa
MQLWGLFLCLVTGPQGVLSDLTLQESGPGLVKPSQTLSLTCAVSGGSVTSSYYWKWICPR
PGKGLEWMEYWTGSTSYNPAFQGRISITADTSKNQFSLQLSSVTTEDTPVYYCARDSERK
SV
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcagctgtggggtcttttcctctgcctggtgacaggtccccaaggtgtcctgtctgac
ctgacactgcaagagtctggcccaggacttgtgaaaccctcacagaccctgtccctcacc
tgtgctgtctccgggggctctgtaaccagcagttactactggaagtggatctgcccgcgc
cctgggaaagggttggagtggatggagtactggacaggaagtacaagctacaaccctgct
ttccaaggccgaatctccatcactgctgacacgtccaagaaccagttctccctgcagctg
agttctgtgaccaccgaggacacacccgtgtattactgtgcaagagacagtgagaggaag
tcagtgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002419
Entry
103002419         CDS       T03086                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8-like
  KO
K06856  immunoglobulin heavy chain
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04613  Neutrophil extracellular trap formation
bacu04640  Hematopoietic cell lineage
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04672  Intestinal immune network for IgA production
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05150  Staphylococcus aureus infection
bacu05152  Tuberculosis
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05202  Transcriptional misregulation in cancer
bacu05310  Asthma
bacu05320  Autoimmune thyroid disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05340  Primary immunodeficiency
bacu05414  Dilated cardiomyopathy
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103002419
   04020 Calcium signaling pathway
    103002419
   04072 Phospholipase D signaling pathway
    103002419
   04151 PI3K-Akt signaling pathway
    103002419
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103002419
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103002419
   04613 Neutrophil extracellular trap formation
    103002419
   04650 Natural killer cell mediated cytotoxicity
    103002419
   04662 B cell receptor signaling pathway
    103002419
   04664 Fc epsilon RI signaling pathway
    103002419
   04666 Fc gamma R-mediated phagocytosis
    103002419
   04672 Intestinal immune network for IgA production
    103002419
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103002419
  09163 Immune disease
   05310 Asthma
    103002419
   05322 Systemic lupus erythematosus
    103002419
   05323 Rheumatoid arthritis
    103002419
   05320 Autoimmune thyroid disease
    103002419
   05330 Allograft rejection
    103002419
   05340 Primary immunodeficiency
    103002419
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103002419
   05416 Viral myocarditis
    103002419
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103002419
   05150 Staphylococcus aureus infection
    103002419
   05152 Tuberculosis
    103002419
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103002419
   05169 Epstein-Barr virus infection
    103002419
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103002419
   05140 Leishmaniasis
    103002419
   05143 African trypanosomiasis
    103002419
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103002419
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103002419
SSDB
Motif
Pfam: V-set Ig_3 ig
Other DBs
NCBI-GeneID: 103002419
NCBI-ProteinID: XP_007188812
LinkDB
Position
Un
AA seq 151 aa
MRLLGLLLCLVTGPQGVLSQVQLQQRGPGLVKPSQTLTLTCAVSGFSITTSSYYWSWIRQ
PPGKGLEWIGYIGYDGSTYYSPSLRSRISISRDTSKNQFSPQLSSVTTEDTAVYYCARDT
VRGSQCEPGHKPPGTRAHNHQVSLWTHQVQG
NT seq 456 nt   +upstreamnt  +downstreamnt
atgaggctgttgggtcttcttctctgcctggtgacaggtccccaaggtgtcctctcccag
gtgcagctgcaacagcgaggcccaggcctggtgaagccctcacagaccctcaccctcacc
tgtgctgtctctggattctccatcacaaccagtagttactactggagctggatccgccag
cccccagggaagggactagagtggatagggtacatagggtatgatggtagcacttactac
agcccatcactcaggagccgcatctccatctccagagacacgtccaaaaatcagttctcc
ccgcagctgagctctgtgaccaccgaggacacagccgtgtattactgtgcgagagacaca
gtgaggggaagtcagtgtgagcctggacacaaacctcccggcaccagggctcataaccac
caggtgtcactctggacccaccaagtacagggctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003240
Entry
103003240         CDS       T03086                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8-like
  KO
K06856  immunoglobulin heavy chain
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04613  Neutrophil extracellular trap formation
bacu04640  Hematopoietic cell lineage
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04672  Intestinal immune network for IgA production
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05150  Staphylococcus aureus infection
bacu05152  Tuberculosis
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05202  Transcriptional misregulation in cancer
bacu05310  Asthma
bacu05320  Autoimmune thyroid disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05340  Primary immunodeficiency
bacu05414  Dilated cardiomyopathy
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103003240
   04020 Calcium signaling pathway
    103003240
   04072 Phospholipase D signaling pathway
    103003240
   04151 PI3K-Akt signaling pathway
    103003240
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103003240
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103003240
   04613 Neutrophil extracellular trap formation
    103003240
   04650 Natural killer cell mediated cytotoxicity
    103003240
   04662 B cell receptor signaling pathway
    103003240
   04664 Fc epsilon RI signaling pathway
    103003240
   04666 Fc gamma R-mediated phagocytosis
    103003240
   04672 Intestinal immune network for IgA production
    103003240
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103003240
  09163 Immune disease
   05310 Asthma
    103003240
   05322 Systemic lupus erythematosus
    103003240
   05323 Rheumatoid arthritis
    103003240
   05320 Autoimmune thyroid disease
    103003240
   05330 Allograft rejection
    103003240
   05340 Primary immunodeficiency
    103003240
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103003240
   05416 Viral myocarditis
    103003240
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103003240
   05150 Staphylococcus aureus infection
    103003240
   05152 Tuberculosis
    103003240
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103003240
   05169 Epstein-Barr virus infection
    103003240
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103003240
   05140 Leishmaniasis
    103003240
   05143 African trypanosomiasis
    103003240
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103003240
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103003240
SSDB
Motif
Pfam: V-set Ig_3 ig I-set C1-set
Other DBs
NCBI-GeneID: 103003240
NCBI-ProteinID: XP_007188813
LinkDB
Position
Un
AA seq 156 aa
MNLICKKMNPLWFFLFLVSAPRGVLTQGQLQESGPSLVTPSQTLSLTCTVSGFSLTSSGV
SWVRQPPGKGLEMVGVMDYSGITVYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYY
CAKDTVRGSQCEARQKPPCTEARNRQGAIRTQQVQG
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaatctcatctgcaagaagatgaatccactgtggttcttcctctttctggtgtcagct
cccagaggtgtcctgacccaggggcagctgcaggagtcgggacccagcctggtgacgccc
tcccagaccctctccctcacctgcactgtctccggattctcattaaccagctctggtgta
tcctgggtcagacagcctccaggaaaggggctggagatggttggtgtgatggattatagt
ggaatcacagtctataacccaactcttaagtcccggctcagcatcaccagggacacctcc
aagagccaagtctatttatcactgagcagcctgacaactgaagacaccgccgtgtattac
tgtgcgaaagacacagtgaggggaagtcagtgtgaggccagacaaaaacctccctgcacg
gaggcccgtaaccgccagggggcgataaggacccaacaagtacagggctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004077
Entry
103004077         CDS       T03086                                 

Definition
(RefSeq) putative V-set and immunoglobulin domain-containing-like protein IGHV4OR15-8-like
  KO
K06856  immunoglobulin heavy chain
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04145  Phagosome
bacu04151  PI3K-Akt signaling pathway
bacu04613  Neutrophil extracellular trap formation
bacu04640  Hematopoietic cell lineage
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04672  Intestinal immune network for IgA production
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05150  Staphylococcus aureus infection
bacu05152  Tuberculosis
bacu05169  Epstein-Barr virus infection
bacu05171  Coronavirus disease - COVID-19
bacu05202  Transcriptional misregulation in cancer
bacu05310  Asthma
bacu05320  Autoimmune thyroid disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05340  Primary immunodeficiency
bacu05414  Dilated cardiomyopathy
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103004077
   04020 Calcium signaling pathway
    103004077
   04072 Phospholipase D signaling pathway
    103004077
   04151 PI3K-Akt signaling pathway
    103004077
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103004077
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103004077
   04613 Neutrophil extracellular trap formation
    103004077
   04650 Natural killer cell mediated cytotoxicity
    103004077
   04662 B cell receptor signaling pathway
    103004077
   04664 Fc epsilon RI signaling pathway
    103004077
   04666 Fc gamma R-mediated phagocytosis
    103004077
   04672 Intestinal immune network for IgA production
    103004077
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103004077
  09163 Immune disease
   05310 Asthma
    103004077
   05322 Systemic lupus erythematosus
    103004077
   05323 Rheumatoid arthritis
    103004077
   05320 Autoimmune thyroid disease
    103004077
   05330 Allograft rejection
    103004077
   05340 Primary immunodeficiency
    103004077
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103004077
   05416 Viral myocarditis
    103004077
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103004077
   05150 Staphylococcus aureus infection
    103004077
   05152 Tuberculosis
    103004077
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103004077
   05169 Epstein-Barr virus infection
    103004077
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103004077
   05140 Leishmaniasis
    103004077
   05143 African trypanosomiasis
    103004077
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103004077
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    103004077
SSDB
Motif
Pfam: V-set Ig_3 I-set ig
Other DBs
NCBI-GeneID: 103004077
NCBI-ProteinID: XP_007188814
LinkDB
Position
Un
AA seq 156 aa
MNLICKKMNPLWFFLFLVSAPRGVLTQGQLQESGPSLVKPSQTLSLTCTVSGFSLTSYAV
GWVRQAPGKGLEYVGIISSGGSAYYNPTLKSRLSITRDTSKSQVYLSLSSLTTEDTAVYY
CAKDTVRGSQCEARQKPPCTEARNRQGAIRTQQVQG
NT seq 471 nt   +upstreamnt  +downstreamnt
atgaatctcatctgcaagaagatgaatccactgtggttcttcctctttctggtgtcagct
cccagaggtgtcctgacccaggggcagctgcaggagtcgggacccagcctggtgaagccc
tcccagaccctctccctcacctgcactgtctccggattctcattaaccagttatgctgta
ggctgggtccgacaggctccaggaaaggggctggagtatgttggtataattagcagtggt
ggaagcgcatattataacccaactcttaagtcccggctcagcatcaccagggacacctcc
aagagccaagtctatttatcactgagcagcctgacaactgaagacaccgccgtgtattac
tgtgcgaaagacacagtgaggggaagtcagtgtgaggccagacaaaaacctccctgcacg
gaggcccgtaaccgccagggggcgataaggacccaacaagtacagggctga

DBGET integrated database retrieval system