KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002194
Entry
103002194         CDS       T03086                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
bacu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103002194
   00052 Galactose metabolism
    103002194
   00500 Starch and sucrose metabolism
    103002194
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103002194
   04151 PI3K-Akt signaling pathway
    103002194
   04152 AMPK signaling pathway
    103002194
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103002194
   04922 Glucagon signaling pathway
    103002194
   04920 Adipocytokine signaling pathway
    103002194
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103002194
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103002194
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103002194
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103002194
NCBI-ProteinID: XP_007177786
UniProt: A0A383ZRQ3
LinkDB
Position
Un
AA seq 366 aa
MEEGMNALHDFGIQSTRYLQVNYQNSQDWFILVSVIADLRNXXXXXXXXXAFYVLFPIWF
HLREAVGIKLLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCET
GPGSPSGHAMGTAGVYYVMVTSTLSIFRGKKKPTYGFRCLNIILWLGFWAVQLNVCLSRI
YLAAHFPHQVVAGVLSGIAVAETFRHIRSIYNASLKKYFLITFFLFSFAIGFYLLLKGLG
VDLLWTLEKAKRRCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKW
FPFRLSCIVVSLVLLHLFDSLKPPSQIELIFYVLSFCKSAAVPLASVSLIPYCLAQVLGQ
PNKKTL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggaggagggaatgaatgctctgcatgactttgggatccagtcaacgcgctacctccag
gtgaattaccagaactcccaggattggttcatcttggtgtccgtgattgcagacctcagg
aatnnnnnnnnnnnnnnnnnnnnnnnnnatgccttttacgtcctcttccccatctggttc
catcttcgagaagctgtgggcatcaaactcctctgggtagctgtgattggagactggctc
aacctcgtctttaagtggattctctttggacagcgcccatactggtgggtcctggacacc
gactactacagcaacacctccgtgccgctgataaagcagttcccggtcacctgtgagacc
ggcccagggagtccctctggccatgccatgggtacggcaggtgtatactatgtgatggtc
acatccaccctctctatctttcggggaaagaaaaagccaacctacggatttcggtgcttg
aacatcattttgtggttgggattctgggcagtgcagctgaacgtctgtctttcacgaatc
taccttgctgctcattttccccatcaagttgttgctggagtcttgtcaggcattgcggtt
gctgagactttccgccacatccggagcatctacaacgccagtctcaagaaatattttctc
attaccttcttcctgttcagttttgccattggattttacctgctgctaaaggggctgggg
gtcgacctcctgtggaccctagagaaagccaagcgaaggtgtgagcggccagaatgggtc
cacattgacactacgccctttgccagcctcctcaagaacctggggacactctttggcctg
ggtctggctctcaactccagcatgtacagggagagctgcaaaggcaagcttagcaaatgg
ttcccgttccgcctcagctgcattgtggtctccctcgtcctcctgcatctctttgactct
ttgaaacccccatcccaaatcgagctgatcttctatgtcctgtccttctgcaagagtgcg
gcagtgcccctggcgtctgtcagtctcatcccctactgcctggcccaggtcctgggccag
ccgaacaagaagactttgtaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002931
Entry
103002931         CDS       T03086                                 

Gene name
G6PC2
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
bacu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103002931 (G6PC2)
   00052 Galactose metabolism
    103002931 (G6PC2)
   00500 Starch and sucrose metabolism
    103002931 (G6PC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103002931 (G6PC2)
   04151 PI3K-Akt signaling pathway
    103002931 (G6PC2)
   04152 AMPK signaling pathway
    103002931 (G6PC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103002931 (G6PC2)
   04922 Glucagon signaling pathway
    103002931 (G6PC2)
   04920 Adipocytokine signaling pathway
    103002931 (G6PC2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103002931 (G6PC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103002931 (G6PC2)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103002931 (G6PC2)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103002931
NCBI-ProteinID: XP_007183290
UniProt: A0A384A7G4
LinkDB
Position
Un
AA seq 355 aa
MDFLHRNGVLIIQHLQKDYRAYYSFLNFMSNVGDPRNIFSIYFPLWFQLNQAVGTKMIWV
AVVGDWFNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALGHTISRMDKSFTTLHRLTWSFLWSLFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPRIQTASLSTYLKTNLFLFLFALGFYLLLRLLDIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGWGFAINSEMFLRSCRGENGYRLSFRLLCTLAS
LTTLQLYHFIKIPTHTEYLFYVLSFCKSASIPLTVVALIPYCIHMLMKPSEKKIH
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttccttcataggaacggagtgctcattattcagcatttgcagaaggactaccga
gcttactacagttttctaaattttatgtccaatgttggagatccccggaatatcttttct
atttattttccactttggtttcaacttaatcaggcagttggaaccaagatgatatgggta
gcagtcgttggggattggttcaatcttatttttaaatggatattatttggtcatcggcct
tactggtgggtccaagaaactcagatttacccaaatcactcaagtccatgccttgaacag
ttccccactacgtgtgaaacaggtccaggaagtccatctggccatgcaatgggctcatca
tgtgtctggtatgtcatggtgacagctgccctgggccacaccatcagtcggatggataag
tcattcaccactctccacagactcacctggtcatttctttggagtcttttttggttgatt
caaatcagtgtctgcatctccagagtattcatagcaacacattttcctcatcaagttatt
cttggagtaattggtggcatgcttgtggcagaggcctttgaacacactccaaggatccaa
acggccagcctgagcacatacttgaagaccaacctcttcctcttcctgtttgcacttggc
ttttacctgcttctcagactgcttgacattgacctgctgtggtccgtgcccatagccaag
aagtggtgtgccaaccctgactggatccacattgacaccacgccttttgctggactcgtg
agaaaccttggggtcctctttggctggggctttgcaatcaactcggagatgttccttagg
agctgccgaggggaaaacggctataggctgagcttccggctgctctgcaccctggcctcg
ttgaccacactgcagctctaccatttcatcaagatcccgactcacacggagtatttattt
tacgtgctgtctttctgtaaaagtgcgtccatcccgctgactgtggttgccctgattccc
tactgtattcatatgttaatgaaaccgagtgaaaaaaagattcattag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004981
Entry
103004981         CDS       T03086                                 

Gene name
G6PC3
Definition
(RefSeq) glucose-6-phosphatase catalytic subunit 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
bacu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103004981 (G6PC3)
   00052 Galactose metabolism
    103004981 (G6PC3)
   00500 Starch and sucrose metabolism
    103004981 (G6PC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103004981 (G6PC3)
   04151 PI3K-Akt signaling pathway
    103004981 (G6PC3)
   04152 AMPK signaling pathway
    103004981 (G6PC3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103004981 (G6PC3)
   04922 Glucagon signaling pathway
    103004981 (G6PC3)
   04920 Adipocytokine signaling pathway
    103004981 (G6PC3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103004981 (G6PC3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103004981 (G6PC3)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103004981 (G6PC3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103004981
NCBI-ProteinID: XP_007180278
UniProt: A0A383ZYS6
LinkDB
Position
Un
AA seq 346 aa
MESTLGAGIAMAEALQNQLPWLENVWLWVTFLGDPKSLFLFYFPVAYYVSRRVGIAVLWI
SLITEWLNLVFKWFLFGDRPFWWVHESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGA
ALWPIMTAISSQVATRTHSRWVRVIPSLAYCTFLLAVGLSRVFLLAHFPHQVLAGLITGA
VLGWLMTPRVPTERELSFYGLTSLALLLGASLIYWTLFTLGLDLSWSINLASKWCERPEW
VHLDSRPFASLSRDSGAALGLGIALHSPCYAQVRRAYLGHGQKLACLVLAMGLLGPLDWL
GYPPQISLFYIFNFLKHTLWPCLVLALVPWLVYTFSAQEAPPIRSS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagtccacgctgggcgccggcatcgcgatggccgaggcgctgcagaaccagctgccc
tggttggagaacgtgtggctctgggtcacctttctgggcgaccccaagagcctttttctg
ttctacttccccgtggcctactacgtctctcgccgggtgggcatcgcggtgctctggatc
agcctcatcaccgagtggctcaacctcgtcttcaagtggtttctgtttggagacaggccc
ttttggtgggtccatgagtctgggtactacagccaggctccagcccaggttcaccagttc
ccctcgtcttgtgaaactggtccaggcagcccttccggacactgtatgatcacaggagca
gccctttggcccataatgacggccatctcttcccaagtggccactcggacccacagccgc
tgggtgagggtgatacctagcttggcttattgcaccttcctgctggcggtcggcttgtcc
cgggtcttcctcttagcacatttccctcaccaggtgttggctggcttaataactggtgct
gtcctgggctggctgatgaccccccgggtgcccacggagcgggagctaagcttctacggg
ttgacctcactggccctcttgctgggtgcgagcctcatctattggaccctctttacactg
ggcctggatctttcttggtccatcaacctagcctctaagtggtgtgagcggcctgagtgg
gtgcacttggacagccggccctttgcctctctgagccgtgactcaggggccgccctgggt
ctgggcatcgcccttcactccccctgctatgcccaggtgcggcgggcatacctgggacac
ggccagaagctagcctgccttgtgttggccatggggctgctgggccccctggactggctg
ggctacccccctcagatcagccttttctacatcttcaatttcctcaagcacaccctctgg
ccatgcctggtcctggccctcgtgccctggctggtgtacacattcagtgcccaggaggca
ccccccatccgctcttcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010774
Entry
103010774         CDS       T03086                                 

Definition
(RefSeq) glucose-6-phosphatase-like
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00010  Glycolysis / Gluconeogenesis
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04910  Insulin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04922  Glucagon signaling pathway
bacu04931  Insulin resistance
bacu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103010774
   00052 Galactose metabolism
    103010774
   00500 Starch and sucrose metabolism
    103010774
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103010774
   04151 PI3K-Akt signaling pathway
    103010774
   04152 AMPK signaling pathway
    103010774
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103010774
   04922 Glucagon signaling pathway
    103010774
   04920 Adipocytokine signaling pathway
    103010774
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103010774
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103010774
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     103010774
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 103010774
NCBI-ProteinID: XP_007177814
UniProt: A0A383ZSB4
LinkDB
Position
Un
AA seq 357 aa
MEEGMNALHDFGIQSTRYLQVNYQNSQDWFILVSVIADLRNAFYVLFPIWFHLREAVGIK
LLWVAVIGDWLNLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLSIFRGKKKPTYGFRCLNIILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFRHIRSIYNASLKKYFLITFFLFSFAIGFYLLLKGLGVDLLWTLEK
AKRRCERPEWVHIDTTPFASLLKNLGTLFGLGLALNSSMYRESCKGKLSKWFPFRLSCIV
VSLVLLHLFDSLKPPSQIELIFYVLSFCKSAAVPLASVSLIPYCLAQVLGQPNKKTL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggagggaatgaatgctctgcatgactttgggatccagtcaacgcgctacctccag
gtgaattaccagaactcccaggattggttcatcttggtgtccgtgattgcagacctcagg
aatgccttttacgtcctcttccccatctggttccatcttcgagaagctgtgggcatcaaa
ctcctctgggtagctgtgattggagactggctcaacctcgtctttaagtggattctcttt
ggacagcgcccatactggtgggtcctggacaccgactactacagcaacacctccgtgccg
ctgataaagcagttcccggtcacctgtgagaccggcccagggagtccctctggccatgcc
atgggtacggcaggtgtatactatgtgatggtcacatccaccctctctatctttcgggga
aagaaaaagccaacctacggatttcggtgcttgaacatcattttgtggttgggattctgg
gcagtgcagctgaacgtctgtctttcacgaatctaccttgctgctcattttccccatcaa
gttgttgctggagtcttgtcaggcattgcggttgctgagactttccgccacatccggagc
atctacaacgccagtctcaagaaatattttctcattaccttcttcctgttcagttttgcc
attggattttacctgctgctaaaggggctgggggtcgacctcctgtggaccctagagaaa
gccaagcgaaggtgtgagcggccagaatgggtccacattgacactacgccctttgccagc
ctcctcaagaacctggggacactctttggcctgggtctggctctcaactccagcatgtac
agggagagctgcaaaggcaagcttagcaaatggttcccgttccgcctcagctgcattgtg
gtctccctcgtcctcctgcatctctttgactctttgaaacccccatcccaaatcgagctg
atcttctatgtcctgtccttctgcaagagtgcggcagtgcccctggcgtctgtcagtctc
atcccctactgcctggcccaggtcctgggccagccgaacaagaagactttgtaa

DBGET integrated database retrieval system