KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002206
Entry
103002206         CDS       T03086                                 

Gene name
NFKBIA
Definition
(RefSeq) NFKB inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04210  Apoptosis
bacu04380  Osteoclast differentiation
bacu04620  Toll-like receptor signaling pathway
bacu04621  NOD-like receptor signaling pathway
bacu04622  RIG-I-like receptor signaling pathway
bacu04623  Cytosolic DNA-sensing pathway
bacu04625  C-type lectin receptor signaling pathway
bacu04657  IL-17 signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04668  TNF signaling pathway
bacu04722  Neurotrophin signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04926  Relaxin signaling pathway
bacu04931  Insulin resistance
bacu05132  Salmonella infection
bacu05134  Legionellosis
bacu05135  Yersinia infection
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05162  Measles
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05203  Viral carcinogenesis
bacu05215  Prostate cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103002206 (NFKBIA)
   04668 TNF signaling pathway
    103002206 (NFKBIA)
   04024 cAMP signaling pathway
    103002206 (NFKBIA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103002206 (NFKBIA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103002206 (NFKBIA)
   04621 NOD-like receptor signaling pathway
    103002206 (NFKBIA)
   04622 RIG-I-like receptor signaling pathway
    103002206 (NFKBIA)
   04623 Cytosolic DNA-sensing pathway
    103002206 (NFKBIA)
   04625 C-type lectin receptor signaling pathway
    103002206 (NFKBIA)
   04660 T cell receptor signaling pathway
    103002206 (NFKBIA)
   04658 Th1 and Th2 cell differentiation
    103002206 (NFKBIA)
   04659 Th17 cell differentiation
    103002206 (NFKBIA)
   04657 IL-17 signaling pathway
    103002206 (NFKBIA)
   04662 B cell receptor signaling pathway
    103002206 (NFKBIA)
   04062 Chemokine signaling pathway
    103002206 (NFKBIA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    103002206 (NFKBIA)
   04926 Relaxin signaling pathway
    103002206 (NFKBIA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    103002206 (NFKBIA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    103002206 (NFKBIA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002206 (NFKBIA)
   05203 Viral carcinogenesis
    103002206 (NFKBIA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103002206 (NFKBIA)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    103002206 (NFKBIA)
   05215 Prostate cancer
    103002206 (NFKBIA)
   05222 Small cell lung cancer
    103002206 (NFKBIA)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103002206 (NFKBIA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103002206 (NFKBIA)
   05135 Yersinia infection
    103002206 (NFKBIA)
   05134 Legionellosis
    103002206 (NFKBIA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103002206 (NFKBIA)
   05170 Human immunodeficiency virus 1 infection
    103002206 (NFKBIA)
   05161 Hepatitis B
    103002206 (NFKBIA)
   05160 Hepatitis C
    103002206 (NFKBIA)
   05171 Coronavirus disease - COVID-19
    103002206 (NFKBIA)
   05164 Influenza A
    103002206 (NFKBIA)
   05162 Measles
    103002206 (NFKBIA)
   05168 Herpes simplex virus 1 infection
    103002206 (NFKBIA)
   05163 Human cytomegalovirus infection
    103002206 (NFKBIA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103002206 (NFKBIA)
   05169 Epstein-Barr virus infection
    103002206 (NFKBIA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103002206 (NFKBIA)
   05140 Leishmaniasis
    103002206 (NFKBIA)
   05142 Chagas disease
    103002206 (NFKBIA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103002206 (NFKBIA)
   04131 Membrane trafficking [BR:bacu04131]
    103002206 (NFKBIA)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103002206 (NFKBIA)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103002206 (NFKBIA)
SSDB
Motif
Pfam: Ank Ank_5 Ank_2 Ank_3 Ank_4
Other DBs
NCBI-GeneID: 103002206
NCBI-ProteinID: XP_007180911
UniProt: A0A384A0P9
LinkDB
Position
Un
AA seq 280 aa
GKHRGLGLQKPRPCAIPRGPRLPGPRAAHSPALRGFPSLPLRFLHLAIIHEEKVLTMEVV
RQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAGALLEAGCDPELRDFRGNTPLHLACEQ
GCLASVGVLTQPRGTQHLHSVLQATNYNGHTCLHLASIHGYLGIVERLVSLGADVNAQEP
CNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTL
ENLQMLPESEDEESYDTESEFTEDELPYDDCVLGGQRLTL
NT seq 843 nt   +upstreamnt  +downstreamnt
ggaaaacaccgcggcctcggcctccagaaaccccgaccttgcgcaatcccccgcgggccg
cgcctccctgggcctcgcgcagcgcactcaccagccctgcggggttttccctctcttccc
ctcagattcctgcacttggccatcatccatgaagagaaggtgctgaccatggaagtggtc
cgccaagtgaagggagacctggcgtttctcaacttccagaacaacctgcagcagactcct
ctccacttggcggtgatcaccaaccagccagaaatcgctggggcacttctggaagctggc
tgtgatcctgagctccgagactttcgaggaaatacccccctacaccttgcctgtgagcag
ggctgcctggccagtgtgggagtcctgactcagccccgcgggacccagcacctccactcc
gtcctgcaagccaccaactacaatggtcacacgtgtctgcacttggcctctattcatggc
tacctgggcatcgtggagcggttggtgtccttgggtgctgatgtcaacgcacaggagccc
tgcaatggccgaactgccctccatctcgcggttgacctgcagaatcctgacctggtgtcg
ctcttgttgaagtgtggggccgacgtcaacagggtcacctaccagggctactccccgtac
cagctcacctggggccgcccaagcacccggatacagcagcagctgggccagctgacccta
gagaaccttcagatgctgcccgagagcgaggatgaggagagctatgacacggagtcagag
ttcacagaggatgagctgccctatgatgactgtgtgcttggaggccagcgcctgacgtta
tga

DBGET integrated database retrieval system