KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002372
Entry
103002372         CDS       T03086                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04150  mTOR signaling pathway
bacu04270  Vascular smooth muscle contraction
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002372 (BRAF)
   04012 ErbB signaling pathway
    103002372 (BRAF)
   04015 Rap1 signaling pathway
    103002372 (BRAF)
   04068 FoxO signaling pathway
    103002372 (BRAF)
   04024 cAMP signaling pathway
    103002372 (BRAF)
   04150 mTOR signaling pathway
    103002372 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002372 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103002372 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103002372 (BRAF)
   04062 Chemokine signaling pathway
    103002372 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103002372 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    103002372 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    103002372 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103002372 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    103002372 (BRAF)
   04720 Long-term potentiation
    103002372 (BRAF)
   04730 Long-term depression
    103002372 (BRAF)
   04722 Neurotrophin signaling pathway
    103002372 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002372 (BRAF)
   05205 Proteoglycans in cancer
    103002372 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103002372 (BRAF)
   05212 Pancreatic cancer
    103002372 (BRAF)
   05225 Hepatocellular carcinoma
    103002372 (BRAF)
   05226 Gastric cancer
    103002372 (BRAF)
   05214 Glioma
    103002372 (BRAF)
   05216 Thyroid cancer
    103002372 (BRAF)
   05221 Acute myeloid leukemia
    103002372 (BRAF)
   05220 Chronic myeloid leukemia
    103002372 (BRAF)
   05218 Melanoma
    103002372 (BRAF)
   05211 Renal cell carcinoma
    103002372 (BRAF)
   05219 Bladder cancer
    103002372 (BRAF)
   05215 Prostate cancer
    103002372 (BRAF)
   05213 Endometrial cancer
    103002372 (BRAF)
   05224 Breast cancer
    103002372 (BRAF)
   05223 Non-small cell lung cancer
    103002372 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103002372 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    103002372 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    103002372 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103002372 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103002372 (BRAF)
   05160 Hepatitis C
    103002372 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103002372 (BRAF)
   01522 Endocrine resistance
    103002372 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002372 (BRAF)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103002372 (BRAF)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103002372 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 103002372
NCBI-ProteinID: XP_007177327
LinkDB
Position
Un
AA seq 870 aa
MSCSTKCLSYCTAVVGLPSRDHKLLEDRALVCPLYIPVPNEHWACNALVRFQLLLEHHPP
RLVNPTLQNRLRTEEKRIKQSHGNGRAEETCELRGGQPGKVPSPDDGARTLRGSRHAPQV
WNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGT
DFSVSSSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRT
VVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVL
ENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLD
LLFVSKFFEHHPIPQEEASLAETTLTSGSSPPPILTSPSPSKSIPIPQPFRPDEDHRNQF
GQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRSDGAPLNQLMRCLRKYQSRTPSPLLHSV
PSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNR
MKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQA
FKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIA
RQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSI
LWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPD
LSKVRSNCPKAMKRLMAESLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAG
FQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgtcgtgctctacaaagtgcctttcgtactgcacagcagttgtcggtctcccctcaagg
gaccataagctgctcgaggacagggccctcgtctgtcctctttatatcccagtaccgaac
gaacactgggcctgcaacgcgttagtgagatttcaacttcttctcgaacaccatcctcct
cgtctagtaaatcctacattacagaacaggcttaggacggaggagaagagaattaaacag
agccatggaaacggccgagcggaggaaacgtgtgagctgcggggtgggcagccggggaag
gtaccctcccctgacgacggcgccaggacgctccgaggatcacgtcacgcacctcaggtg
tggaatatcaaacaaatgattaagttgacacaggagcatatagaggccctactggacaaa
tttggtggggagcataatccaccatcaatatatctggaggcctatgaagaatacaccagc
aagctagatgccctccaacaaagagaacaacagttattggaatccctggggaatggaact
gatttttctgtttctagctctgcatcaacagacaccgttacatcttcttcctcttctagc
ctttcagtgctgccttcatctctttcagtttttcaaaatcccacagatgtgtcacggagc
aaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaataaacagaggaca
gtggtacctgcaaggtgtggagttacagtccgggacagcctgaagaaagcactgatgatg
agaggtctaatcccagagtgctgcgctgtttacagaattcaggatggagagaagaaacca
attggctgggacactgatatttcctggcttactggagaggaattgcatgtagaagtgttg
gagaatgttccacttacaacacacaactttgtacggaaaacttttttcaccttagcattt
tgtgacttctgtcgaaagctgcttttccaggggttccgctgtcaaacatgtggttataaa
tttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaacttgat
ttgctgtttgtctccaagttctttgaacaccaccccataccacaggaggaggcctcctta
gcagagactacccttacgtctggatcatccccgcccccaattctcaccagtccgtctcct
tcaaaatccattccaattccacagcctttccgaccagatgaagatcatcgaaatcagttt
ggacaacgagaccggtcctcatcagctccaaatgtgcatataaacaccatagaacctgtc
aatattgatgacttgattagagaccaagggtttcgtagtgatggagcccctttgaaccag
ctgatgcgctgtcttcggaaataccaatcccggactcccagtcccctcctacattctgtc
cccagtgaaatagtgtttgattttgagcctggcccagtgttcagaggatcaaccacaggt
ttatctgccacgccccctgcctcattacctggctcactcactaatgtgaaagcattacag
aaatctccaggacctcagcgagaaaggaagtcatcttcatcctcagaagacaggaatcga
atgaaaacacttggtagacgggattcaagtgacgattgggagattcctgatgggcagatc
acggtgggacaaagaattggatccgggtcatttgggacagtctacaagggaaagtggcat
ggtgatgtggcagtgaaaatgttgaatgtgacagcacccacacctcagcagttacaggcc
ttcaaaaatgaagtaggagtactcaggaaaactcgacatgtgaatatcctactcttcatg
ggttattcaacgaagccacaactggctattgttacccagtggtgtgagggctccagctta
tatcatcatctccacatcattgagaccaaattcgagatgatcaaacttatagatattgca
cgacagactgcacagggcatggattacttacacgccaagtcaatcatccacagagacctc
aagagtaataatatttttcttcatgaagacctcacagtaaaaataggtgattttggtcta
gccacagtgaaatctcgatggagtgggtcccatcaatttgaacagttgtctggatccatt
ttgtggatggcaccagaagtaatcagaatgcaagataaaaacccatatagctttcagtca
gatgtatatgcatttgggattgttctgtatgaattgatgaccggacagttaccttattca
aacatcaacaacagggaccagataatttttatggtgggacgaggatatctatctccagat
ctcagtaaggtacggagtaactgtccaaaagccatgaagagattaatggcagagagccta
aaaaagaaaagagatgagagacccctctttccccaaattctcgcctctattgagctgctg
gcccgctcattgccaaaaattcaccgcagtgcatccgaaccctctttgaatcgggctggc
ttccaaacagaggattttagtctgtatgcttgtgcttctccaaaaacacccatccaggca
gggggatatggagaatttgcagccttcaagtag

DBGET integrated database retrieval system