KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002372
Entry
103002372         CDS       T03086                                 

Gene name
BRAF
Definition
(RefSeq) B-Raf proto-oncogene, serine/threonine kinase
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04015  Rap1 signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04150  mTOR signaling pathway
bacu04270  Vascular smooth muscle contraction
bacu04510  Focal adhesion
bacu04650  Natural killer cell mediated cytotoxicity
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002372 (BRAF)
   04012 ErbB signaling pathway
    103002372 (BRAF)
   04015 Rap1 signaling pathway
    103002372 (BRAF)
   04068 FoxO signaling pathway
    103002372 (BRAF)
   04024 cAMP signaling pathway
    103002372 (BRAF)
   04150 mTOR signaling pathway
    103002372 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002372 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103002372 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103002372 (BRAF)
   04062 Chemokine signaling pathway
    103002372 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103002372 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    103002372 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    103002372 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103002372 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    103002372 (BRAF)
   04720 Long-term potentiation
    103002372 (BRAF)
   04730 Long-term depression
    103002372 (BRAF)
   04722 Neurotrophin signaling pathway
    103002372 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002372 (BRAF)
   05205 Proteoglycans in cancer
    103002372 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103002372 (BRAF)
   05212 Pancreatic cancer
    103002372 (BRAF)
   05225 Hepatocellular carcinoma
    103002372 (BRAF)
   05226 Gastric cancer
    103002372 (BRAF)
   05214 Glioma
    103002372 (BRAF)
   05216 Thyroid cancer
    103002372 (BRAF)
   05221 Acute myeloid leukemia
    103002372 (BRAF)
   05220 Chronic myeloid leukemia
    103002372 (BRAF)
   05218 Melanoma
    103002372 (BRAF)
   05211 Renal cell carcinoma
    103002372 (BRAF)
   05219 Bladder cancer
    103002372 (BRAF)
   05215 Prostate cancer
    103002372 (BRAF)
   05213 Endometrial cancer
    103002372 (BRAF)
   05224 Breast cancer
    103002372 (BRAF)
   05223 Non-small cell lung cancer
    103002372 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103002372 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    103002372 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    103002372 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103002372 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103002372 (BRAF)
   05160 Hepatitis C
    103002372 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103002372 (BRAF)
   01522 Endocrine resistance
    103002372 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002372 (BRAF)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103002372 (BRAF)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103002372 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 103002372
NCBI-ProteinID: XP_007177327
LinkDB
Position
Un
AA seq 870 aa
MSCSTKCLSYCTAVVGLPSRDHKLLEDRALVCPLYIPVPNEHWACNALVRFQLLLEHHPP
RLVNPTLQNRLRTEEKRIKQSHGNGRAEETCELRGGQPGKVPSPDDGARTLRGSRHAPQV
WNIKQMIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGT
DFSVSSSASTDTVTSSSSSSLSVLPSSLSVFQNPTDVSRSNPKSPQKPIVRVFLPNKQRT
VVPARCGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVL
ENVPLTTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLD
LLFVSKFFEHHPIPQEEASLAETTLTSGSSPPPILTSPSPSKSIPIPQPFRPDEDHRNQF
GQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRSDGAPLNQLMRCLRKYQSRTPSPLLHSV
PSEIVFDFEPGPVFRGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNR
MKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQA
FKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIA
RQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSI
LWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPD
LSKVRSNCPKAMKRLMAESLKKKRDERPLFPQILASIELLARSLPKIHRSASEPSLNRAG
FQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgtcgtgctctacaaagtgcctttcgtactgcacagcagttgtcggtctcccctcaagg
gaccataagctgctcgaggacagggccctcgtctgtcctctttatatcccagtaccgaac
gaacactgggcctgcaacgcgttagtgagatttcaacttcttctcgaacaccatcctcct
cgtctagtaaatcctacattacagaacaggcttaggacggaggagaagagaattaaacag
agccatggaaacggccgagcggaggaaacgtgtgagctgcggggtgggcagccggggaag
gtaccctcccctgacgacggcgccaggacgctccgaggatcacgtcacgcacctcaggtg
tggaatatcaaacaaatgattaagttgacacaggagcatatagaggccctactggacaaa
tttggtggggagcataatccaccatcaatatatctggaggcctatgaagaatacaccagc
aagctagatgccctccaacaaagagaacaacagttattggaatccctggggaatggaact
gatttttctgtttctagctctgcatcaacagacaccgttacatcttcttcctcttctagc
ctttcagtgctgccttcatctctttcagtttttcaaaatcccacagatgtgtcacggagc
aaccccaagtcaccacaaaaacctatcgttagagtcttcctgcccaataaacagaggaca
gtggtacctgcaaggtgtggagttacagtccgggacagcctgaagaaagcactgatgatg
agaggtctaatcccagagtgctgcgctgtttacagaattcaggatggagagaagaaacca
attggctgggacactgatatttcctggcttactggagaggaattgcatgtagaagtgttg
gagaatgttccacttacaacacacaactttgtacggaaaacttttttcaccttagcattt
tgtgacttctgtcgaaagctgcttttccaggggttccgctgtcaaacatgtggttataaa
tttcaccagcgttgtagtacagaggttccactgatgtgtgttaattatgaccaacttgat
ttgctgtttgtctccaagttctttgaacaccaccccataccacaggaggaggcctcctta
gcagagactacccttacgtctggatcatccccgcccccaattctcaccagtccgtctcct
tcaaaatccattccaattccacagcctttccgaccagatgaagatcatcgaaatcagttt
ggacaacgagaccggtcctcatcagctccaaatgtgcatataaacaccatagaacctgtc
aatattgatgacttgattagagaccaagggtttcgtagtgatggagcccctttgaaccag
ctgatgcgctgtcttcggaaataccaatcccggactcccagtcccctcctacattctgtc
cccagtgaaatagtgtttgattttgagcctggcccagtgttcagaggatcaaccacaggt
ttatctgccacgccccctgcctcattacctggctcactcactaatgtgaaagcattacag
aaatctccaggacctcagcgagaaaggaagtcatcttcatcctcagaagacaggaatcga
atgaaaacacttggtagacgggattcaagtgacgattgggagattcctgatgggcagatc
acggtgggacaaagaattggatccgggtcatttgggacagtctacaagggaaagtggcat
ggtgatgtggcagtgaaaatgttgaatgtgacagcacccacacctcagcagttacaggcc
ttcaaaaatgaagtaggagtactcaggaaaactcgacatgtgaatatcctactcttcatg
ggttattcaacgaagccacaactggctattgttacccagtggtgtgagggctccagctta
tatcatcatctccacatcattgagaccaaattcgagatgatcaaacttatagatattgca
cgacagactgcacagggcatggattacttacacgccaagtcaatcatccacagagacctc
aagagtaataatatttttcttcatgaagacctcacagtaaaaataggtgattttggtcta
gccacagtgaaatctcgatggagtgggtcccatcaatttgaacagttgtctggatccatt
ttgtggatggcaccagaagtaatcagaatgcaagataaaaacccatatagctttcagtca
gatgtatatgcatttgggattgttctgtatgaattgatgaccggacagttaccttattca
aacatcaacaacagggaccagataatttttatggtgggacgaggatatctatctccagat
ctcagtaaggtacggagtaactgtccaaaagccatgaagagattaatggcagagagccta
aaaaagaaaagagatgagagacccctctttccccaaattctcgcctctattgagctgctg
gcccgctcattgccaaaaattcaccgcagtgcatccgaaccctctttgaatcgggctggc
ttccaaacagaggattttagtctgtatgcttgtgcttctccaaaaacacccatccaggca
gggggatatggagaatttgcagccttcaagtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014337
Entry
103014337         CDS       T03086                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04022  cGMP-PKG signaling pathway
bacu04024  cAMP signaling pathway
bacu04062  Chemokine signaling pathway
bacu04068  FoxO signaling pathway
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04218  Cellular senescence
bacu04270  Vascular smooth muscle contraction
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04371  Apelin signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04613  Neutrophil extracellular trap formation
bacu04625  C-type lectin receptor signaling pathway
bacu04630  JAK-STAT signaling pathway
bacu04650  Natural killer cell mediated cytotoxicity
bacu04660  T cell receptor signaling pathway
bacu04662  B cell receptor signaling pathway
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04720  Long-term potentiation
bacu04722  Neurotrophin signaling pathway
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04912  GnRH signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04917  Prolactin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05132  Salmonella infection
bacu05152  Tuberculosis
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103014337 (RAF1)
   04012 ErbB signaling pathway
    103014337 (RAF1)
   04014 Ras signaling pathway
    103014337 (RAF1)
   04015 Rap1 signaling pathway
    103014337 (RAF1)
   04370 VEGF signaling pathway
    103014337 (RAF1)
   04371 Apelin signaling pathway
    103014337 (RAF1)
   04630 JAK-STAT signaling pathway
    103014337 (RAF1)
   04068 FoxO signaling pathway
    103014337 (RAF1)
   04072 Phospholipase D signaling pathway
    103014337 (RAF1)
   04071 Sphingolipid signaling pathway
    103014337 (RAF1)
   04024 cAMP signaling pathway
    103014337 (RAF1)
   04022 cGMP-PKG signaling pathway
    103014337 (RAF1)
   04151 PI3K-Akt signaling pathway
    103014337 (RAF1)
   04150 mTOR signaling pathway
    103014337 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103014337 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    103014337 (RAF1)
   04218 Cellular senescence
    103014337 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103014337 (RAF1)
   04540 Gap junction
    103014337 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103014337 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103014337 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103014337 (RAF1)
   04625 C-type lectin receptor signaling pathway
    103014337 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    103014337 (RAF1)
   04660 T cell receptor signaling pathway
    103014337 (RAF1)
   04662 B cell receptor signaling pathway
    103014337 (RAF1)
   04664 Fc epsilon RI signaling pathway
    103014337 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    103014337 (RAF1)
   04062 Chemokine signaling pathway
    103014337 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103014337 (RAF1)
   04929 GnRH secretion
    103014337 (RAF1)
   04912 GnRH signaling pathway
    103014337 (RAF1)
   04915 Estrogen signaling pathway
    103014337 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    103014337 (RAF1)
   04917 Prolactin signaling pathway
    103014337 (RAF1)
   04921 Oxytocin signaling pathway
    103014337 (RAF1)
   04926 Relaxin signaling pathway
    103014337 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    103014337 (RAF1)
   04919 Thyroid hormone signaling pathway
    103014337 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    103014337 (RAF1)
   04916 Melanogenesis
    103014337 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103014337 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    103014337 (RAF1)
   04720 Long-term potentiation
    103014337 (RAF1)
   04730 Long-term depression
    103014337 (RAF1)
   04722 Neurotrophin signaling pathway
    103014337 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    103014337 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103014337 (RAF1)
   05206 MicroRNAs in cancer
    103014337 (RAF1)
   05205 Proteoglycans in cancer
    103014337 (RAF1)
   05230 Central carbon metabolism in cancer
    103014337 (RAF1)
   05231 Choline metabolism in cancer
    103014337 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103014337 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103014337 (RAF1)
   05212 Pancreatic cancer
    103014337 (RAF1)
   05225 Hepatocellular carcinoma
    103014337 (RAF1)
   05226 Gastric cancer
    103014337 (RAF1)
   05214 Glioma
    103014337 (RAF1)
   05221 Acute myeloid leukemia
    103014337 (RAF1)
   05220 Chronic myeloid leukemia
    103014337 (RAF1)
   05218 Melanoma
    103014337 (RAF1)
   05211 Renal cell carcinoma
    103014337 (RAF1)
   05219 Bladder cancer
    103014337 (RAF1)
   05215 Prostate cancer
    103014337 (RAF1)
   05213 Endometrial cancer
    103014337 (RAF1)
   05224 Breast cancer
    103014337 (RAF1)
   05223 Non-small cell lung cancer
    103014337 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103014337 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    103014337 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    103014337 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103014337 (RAF1)
   05152 Tuberculosis
    103014337 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103014337 (RAF1)
   05161 Hepatitis B
    103014337 (RAF1)
   05160 Hepatitis C
    103014337 (RAF1)
   05164 Influenza A
    103014337 (RAF1)
   05163 Human cytomegalovirus infection
    103014337 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103014337 (RAF1)
   05165 Human papillomavirus infection
    103014337 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103014337 (RAF1)
   01522 Endocrine resistance
    103014337 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103014337 (RAF1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103014337 (RAF1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103014337 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 103014337
NCBI-ProteinID: XP_007192656
UniProt: A0A384AYZ0
LinkDB
Position
Un
AA seq 668 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSIVGDSGIPVMPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTNLPVDSRMIENNSLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSSTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHISNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagatgcg
gtgtttgatggccccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaacttacggacccttctaagacaagcaacactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagttttcaga
cttctccacgaacacaagggtaaaaaagcacgtttagattggaatactgatgctgcctca
ttgattggagaggaacttcaagtagatttcttggatcatgttccgctcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgcta
aatgggtttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttgctgttcccaaattccatt
gttggtgatagtgggatcccagtaatgccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgctttcacattc
aacacctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacatccaca
cctaatgtccacatggtcagcaccaacttgcccgtggacagcaggatgattgagaataac
agcctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagtcacagtgaatcagcctcaccttcagccttgtccagcagtcccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcaccg
ggatccagcacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagacgttgcagtaaagattctaaaggttgtt
gatcccacaccagagcagttccaggcctttaggaatgaagtggctgtccttcgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctataaacacctgcacgtccaggagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagattttggtttggcaacagtgaagtcgcgctggagtggttctcag
caggttgaacaacccaccggctccatcttgtggatggccccagaggtgattcgaatgcag
gacaataacccgttcagcttccagtccgacgtctactcgtatggcatcgtgctgtacgag
ctcatgacgggggagctgccctactcccacatcagcaaccgcgatcagatcatcttcatg
gtgggccgagggtacgcctccccagaccttagtaagctgtacaagaactgccccaaagca
atgaagaggctggtagccgactgtgtgaagaaagttaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccataccgaggacatcaatgcctgcacgctgacc
acatcccctagattgcctgtcttctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020975
Entry
103020975         CDS       T03086                                 

Gene name
ARAF
Definition
(RefSeq) A-Raf proto-oncogene, serine/threonine kinase
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04068  FoxO signaling pathway
bacu04270  Vascular smooth muscle contraction
bacu04650  Natural killer cell mediated cytotoxicity
bacu04720  Long-term potentiation
bacu04726  Serotonergic synapse
bacu04730  Long-term depression
bacu04810  Regulation of actin cytoskeleton
bacu04910  Insulin signaling pathway
bacu04914  Progesterone-mediated oocyte maturation
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05034  Alcoholism
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05221  Acute myeloid leukemia
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103020975 (ARAF)
   04012 ErbB signaling pathway
    103020975 (ARAF)
   04068 FoxO signaling pathway
    103020975 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103020975 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103020975 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103020975 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    103020975 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    103020975 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103020975 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    103020975 (ARAF)
   04720 Long-term potentiation
    103020975 (ARAF)
   04730 Long-term depression
    103020975 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103020975 (ARAF)
   05205 Proteoglycans in cancer
    103020975 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103020975 (ARAF)
   05212 Pancreatic cancer
    103020975 (ARAF)
   05225 Hepatocellular carcinoma
    103020975 (ARAF)
   05226 Gastric cancer
    103020975 (ARAF)
   05214 Glioma
    103020975 (ARAF)
   05221 Acute myeloid leukemia
    103020975 (ARAF)
   05220 Chronic myeloid leukemia
    103020975 (ARAF)
   05218 Melanoma
    103020975 (ARAF)
   05211 Renal cell carcinoma
    103020975 (ARAF)
   05219 Bladder cancer
    103020975 (ARAF)
   05215 Prostate cancer
    103020975 (ARAF)
   05213 Endometrial cancer
    103020975 (ARAF)
   05224 Breast cancer
    103020975 (ARAF)
   05223 Non-small cell lung cancer
    103020975 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020975 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    103020975 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    103020975 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103020975 (ARAF)
   05160 Hepatitis C
    103020975 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103020975 (ARAF)
   01522 Endocrine resistance
    103020975 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103020975 (ARAF)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103020975 (ARAF)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   103020975 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal APH TUG-UBL1 Kdo
Other DBs
NCBI-GeneID: 103020975
NCBI-ProteinID: XP_007180328
UniProt: A0A383ZYX6
LinkDB
Position
Un
AA seq 611 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIKGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNRRQFYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSLSPASSCTQHRDPKHFPFPAPANAPLQRIRSTSTPNVHMVSTTAPMDSGLIQLP
AQSFNTDAAGNRGGGDGTPRGSPSPASVSSGRKSPHSKSPSEQRERKSLADDKKKVKNLG
YRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGDVAVKVLKVAQPTAEQAQAFKNEM
QVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYHHLHVADTRFDMVQLIDVARQTAQ
GMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLATVKTRWSGAQPLEQPSGSVLWMAA
EVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHIGSRDQIIFMVGRGYLSPDLSKIS
SNCPKAMRRLLSDCLKFQREERPLFPQILATIELLQRSLPKIERSASEPSLHRTQADELP
ACLLSAARLVP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaacggggccgagccgtcccgggcagtgggcacc
gtcaaagtgtacctgcccaacaagcaacgcacggtggtgactgtccgggatggcatgagt
gtctacgactctctagacaaggccctcaaggtgcggggtctcaatcaggattgctgtgtg
gtctaccggctcatcaaggggcgaaagacagtcaccgcctgggacacagccattgccccc
ctggatggcgaggagctcattgtggaggtcctcgaagacgtccccctgaccatgcacaat
tttgtacggaagacgttcttcagcctggccttttgtgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggatacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgtcgacatgagtaccaaccgccgacagttctaccacagtgtccaggat
ttgtccggaggctccagacagcatgaggctccctcgaaccgccccctgaatgagccactc
acccctcagggtcccagcctttcccctgccagctcctgcacccagcaccgcgaccccaag
cacttccccttccctgccccggccaacgcccccctccagcgcatccgctccacatccacc
cccaacgtccacatggtcagcaccacagcccccatggactccggcctcatccagctccct
gcccagagtttcaacactgacgctgccgggaatagaggtggtggcgatggaaccccccgg
gggagccccagcccggccagcgtgtcctcggggaggaagtccccacattccaagtccccg
tcagagcagcgggagcggaagtccttggccgatgacaagaagaaagtgaagaatctgggg
taccgggactcgggctattactgggaggtgccacccagtgaggtgcagctgctgaagagg
atcgggacgggctcgtttgggaccgtgtttcgtgggcggtggcacggcgatgtggccgtg
aaggtgctcaaggtggcccaacccacagctgagcaggcccaggccttcaagaacgagatg
caggtgctcaggaagacacgtcacgtcaacatcttgctgttcatgggcttcatgacccgg
ccgggatttgccatcatcacacagtggtgcgagggctccagtctctaccaccacctgcac
gtggccgacacacgcttcgacatggtccagctcattgacgtggcccggcagactgcccag
ggcatggactacctccatgccaagaacatcatccatcgagatctcaagtcgaacaacatc
ttcctacacgaggggctcacggtgaagattggggactttggcctggccacagtgaagacg
cggtggagtggagcccagcctttggagcagccctcgggctctgtgctatggatggcagct
gaggtgatccgtatgcaggacccgaacccctacagcttccagtcagatgtctatgcctat
ggggttgtgctctacgagctcatgaccggctcgctgccttacagccacattggcagccgt
gaccagattatctttatggtgggccgtggctatctgtccccggacctcagcaaaatctcc
agcaactgccccaaggccatgaggcgcctgctgtctgactgccttaagttccagcgggag
gagcggcccctcttcccacagatcctggccacgattgagctgctgcagcggtcactcccc
aagattgagcggagtgcctccgaaccctccttgcaccgtacccaggctgatgagttgcct
gcctgcctactcagcgcagcccgccttgtgccttag

DBGET integrated database retrieval system