KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002380
Entry
103002380         CDS       T03086                                 

Gene name
EIF4B
Definition
(RefSeq) eukaryotic translation initiation factor 4B
  KO
K03258  translation initiation factor 4B
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03013  RNA transport
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103002380 (EIF4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103002380 (EIF4B)
   04150 mTOR signaling pathway
    103002380 (EIF4B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103002380 (EIF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bacu03019]
    103002380 (EIF4B)
   03012 Translation factors [BR:bacu03012]
    103002380 (EIF4B)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     103002380 (EIF4B)
   mRNA cycle factors
    Stress granule specific factors
     103002380 (EIF4B)
Translation factors [BR:bacu03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    103002380 (EIF4B)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 103002380
NCBI-ProteinID: XP_007179473
UniProt: A0A383ZWH2
LinkDB
Position
Un
AA seq 617 aa
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKFRDRYDSDRYRDGYRDS
YREGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDFRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSSRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSATSGRSKSDQDARRRESEKSLENETPNKEEDCQSPTSKPPKPEQPLKVMP
APPPKENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVVPAQPSEEGPVRKADENKVDGVS
APKGQSGNSSRGPGDGGNKDHWKESDRKDGKKDQDSRSALEPKKAEENPASKFSSASKYA
ALAVDGEDENEGEDYTE
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaagactatctccctaacagacttc
ctggctgaggatggagggactggtggaggaagcacctatgtccccaaaccagtcagctgg
gctgatgaaacagatgacctagaaggagatgtttcaaccacttggcatagtaatgatgat
gacgtgtatagggcacctccaattgaccgttccatcctgcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttcccaaatcaccaccctacactgcttttcta
gggaacctgccctatgatgtgacagaagactccattaaggaattctttagaggattaaat
atcagtgcagtgcgtttaccacgtgaacccagcaatcctgagaggttgaaaggttttggt
tacgctgagtttgaggacctggattccttgctcagtgccctgagcctcaatgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcacaggataaagacagggat
gatcgttcttttggcagagatagaaatcgggattctgacaaaacagatacagactggagg
gcccgtcctgctacagacagctttgatgactacccacctagaagaggtgacgatagcttt
ggagacaagtttcgagatcgttatgattcagaccgatatcgtgatgggtatcgggacagt
taccgtgagggcccacgccgggacatggatcgatacgggggccgagatcgctatgatgac
cgaggcagcagagactatgatagaggctatgattccaggataggcagtggcagaagagca
tttggtagtgggtaccgtagggatgacgacttcagaggaggtggggaccgctatgaagac
agatatgacagacgagatgaccggtcgtggagctccagagatgattactctcgggatgat
tataggcgtgatgatagaggtcccccccaaagacccaaactgaacctaaagcctcggagt
actcctaaggaagatgattcctctgctagcacatcccagtccagtcgagcagcctctatc
tttggaggggcaaagcctgttgacacagctgctagagaacgagaagtagaagagcggcta
cagaaggaacaggagaaactgcagcgtcagctggatgagccaaaactagaacgacggcct
cgggagagacacccaagctggcgaagtgaagaaactcaggaacgggaacggtcgaggaca
ggaagtgagtcatcacagacggggacctcagccacatctggcagaagtaagtcagaccag
gatgcacgaaggagagagagtgagaagtctctagaaaatgaaacacccaataaagaggaa
gactgtcagtctccaacttctaagcctcccaaacctgaacagcctctaaaggtaatgcca
gcccctccaccaaaggagaatgcttgggtgaagcgaagttctaaccctcctgctcgatct
cagagctcagacacagagcagcagtcccctacaagtggtggagggaaagtagttccagct
caaccatctgaggaaggaccagtaaggaaagcagatgaaaataaagtagatggggtgagt
gccccaaaaggccaaagtggaaattccagccgtggtccaggagatggagggaacaaagac
cactggaaggagtcagataggaaagatggcaaaaaggatcaagactccagatctgcactt
gagccaaagaaagctgaagaaaatccagcctctaagttcagttctgcaagcaagtatgct
gctcttgccgttgatggtgaagatgaaaatgagggagaagattacaccgaatag

DBGET integrated database retrieval system