KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002640
Entry
103002640         CDS       T03086                                 

Gene name
ERBB2
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05215  Prostate cancer
bacu05219  Bladder cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103002640 (ERBB2)
   04012 ErbB signaling pathway
    103002640 (ERBB2)
   04066 HIF-1 signaling pathway
    103002640 (ERBB2)
   04020 Calcium signaling pathway
    103002640 (ERBB2)
   04151 PI3K-Akt signaling pathway
    103002640 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103002640 (ERBB2)
   04520 Adherens junction
    103002640 (ERBB2)
   04530 Tight junction
    103002640 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002640 (ERBB2)
   05206 MicroRNAs in cancer
    103002640 (ERBB2)
   05205 Proteoglycans in cancer
    103002640 (ERBB2)
   05230 Central carbon metabolism in cancer
    103002640 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103002640 (ERBB2)
   05226 Gastric cancer
    103002640 (ERBB2)
   05219 Bladder cancer
    103002640 (ERBB2)
   05215 Prostate cancer
    103002640 (ERBB2)
   05213 Endometrial cancer
    103002640 (ERBB2)
   05224 Breast cancer
    103002640 (ERBB2)
   05223 Non-small cell lung cancer
    103002640 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103002640 (ERBB2)
   01524 Platinum drug resistance
    103002640 (ERBB2)
   01522 Endocrine resistance
    103002640 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103002640 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103002640 (ERBB2)
   04090 CD molecules [BR:bacu04090]
    103002640 (ERBB2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103002640 (ERBB2)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   103002640 (ERBB2)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   103002640 (ERBB2)
CD molecules [BR:bacu04090]
 Proteins
  103002640 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 103002640
NCBI-ProteinID: XP_007177626
UniProt: A0A383ZR87
LinkDB
Position
Un
AA seq 1255 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLQLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPSNASLSFLQEIQEVQGYVLIAHNQVSQVPLQRLRIVRGTQLFKDNYALAVLDNG
DLLESATPAARAAPGGLQELQLRSLTEILKGGVLIQRNPRLCHQDTILWKDIFHKNNQLA
LMLRDTNRSRACPPCSPACKAPHCWGESSKDCQSLTGTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDRASNTAPLQPEQLGVFESLEEITGYLYISAWPDSLP
DLHVFQNLRVIRGRVLHDGAYSLTLQGLGIRWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEVECVGEGLACYPLCAHGHCWGPGPTQGVNCSQFLRGQQC
VEXCRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACAHHKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGMCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLVVVVGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLXNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPTSPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGSGGTAHRRHRSTSTRSGGGELTLGLAPSEEEPPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQNLPQHDSSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPRPPPRPAGSTLERPKTLSPGKNGVVKDIFAFGAAVENPEYLAPR
GRAAPQSHPSPAFSPAFDNLYYWDQDPSERGSPPSTFEGTPTAENPEYLGLDMPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcagctgccggccagtcccgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggtgcagggtaacctg
gagctcacctacctgccctctaatgccagcctctccttcctgcaggagatccaggaggtg
cagggctacgtgctcatcgctcacaaccaagtgagtcaggtccccctgcagaggctgcgg
atcgtgcgaggcacccagctgtttaaggacaactatgccctggccgtgctggacaatgga
gaccttctggaaagtgccacccctgctgcacgcgctgctccgggagggttgcaggagctg
cagctgcgaagcctcacagagatcctgaagggaggggtcttgatccagcggaacccccgg
ctctgccaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggcc
ctcatgctgagggacaccaaccgctcacgggcctgcccaccctgttctccagcttgtaaa
gctccccactgctggggagaaagttccaaggactgtcagagcttgacgggaaccgtctgt
gccagcggctgtgcccgctgtaagggcccgcagcccaccgactgctgccacgagcagtgt
gctgccggctgcacgggccccaagcactctgactgtctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tccatgcccaaccccgagggccgttacaccttcggtgccagctgcgtgaccgcctgtcct
tacaactacctgtctacggacgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcggtcaccagtgccaac
atccaggagtttgctggctgcaagaagatctttgggagcctggcgtttctgccggagagc
tttgagggggaccgagcctccaacactgccccgctacagcctgagcagctcggagtattt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgccg
gacctccatgtcttccagaatctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatccgctggctggggctgcgttcgctgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccgcctctgctttgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgccaaccggcca
gaggtcgagtgcgtgggcgagggcctggcctgctacccgctgtgtgcccacgggcactgc
tggggtccagggcccacccagggcgtcaactgcagccagttccttcggggccagcagtgc
gtggaataatgccgagtactgcaggggcttccccgggagtacgtgaaggacaggtactgt
ctgccgtgccaccccgagtgtcagccccagaatggctcagtgacctgctttggctcggag
gctgaccagtgtgtggcctgcgcccaccacaaggatcctcccttctgcgtggctcgctgc
cccagtggtgtgaagcctgacctctccttcatgcccatctggaagttcccagatgaggaa
ggcatgtgccagccatgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccctgccgagcagagagccagccctgtgacgtccatcattgccgctgtggtgggc
attctgctggtcgttgtcgtggggctggtctttggcatcctcatcaagcgaaggcggcag
aagatccggaagtacacgatgcggaggctgctgcaggagacagagctggtggagcccctg
acaccgagcggagcgatgccaaatcaggctcagatgcggatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggcaccgtctacaagggcatctggatc
cccgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgtagggtcccca
tacgtgtcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgggagcaccgcgggcgcctgggctcccag
gacctgcngaactggtgtgtgcagattgccaaggggatgagctacttggaggacgtgcgg
ctcgtgcacagggacctggctgcccggaatgtgctggtcaagagtcccaaccacgtcaag
attacagactttgggctggctcggctgctggacattgacgagacagagtaccatgcggat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgaggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaagacttgggccctaccagccccttg
gacagcaccttctaccgctcactgctggaggatgacgacatgggggacctggtggatgct
gaggagtacctggtaccccagcaaggcttcttctgcccagaccctgccccgggctccggg
ggcacagcccaccgcaggcaccgcagcacatccaccaggagtggcggtggtgagctgacg
ctgggtctggcgccctcggaggaggagccccccaggtctccactggcaccttccgaaggc
gctggctctgacgtgtttgacggtgacttgggaatgggggcagccaaggggctgcagaac
ctcccccaacatgactccagccctctacagcggtacagcgaggaccccacagtaccgctt
cctcccgagaccgatggctacgttgcccccctgacctgcagcccccagcccgaatacgtg
aaccagccagaggttcggccacagcccccttcacccctagagggtcctcggcctcctcct
cgacctgccggttccactctggaaaggcccaagactctctcccctgggaagaatggggtt
gtcaaagacatttttgcctttggggctgccgtggagaaccccgagtacttggcaccccgg
ggcagggctgcccctcagtcccacccttctccggccttcagcccagcctttgacaacctc
tattactgggaccaggacccatcagagcggggctctccacccagcacctttgaagggacc
cctacagcagagaaccccgagtacctgggtctggacatgccagtatga

DBGET integrated database retrieval system