KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103002651
Entry
103002651         CDS       T03086                                 

Gene name
DLL3
Definition
(RefSeq) delta like canonical Notch ligand 3
  KO
K06051  delta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103002651 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103002651 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103002651 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    103002651 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103002651 (DLL3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 MNNL EGF_CA
Other DBs
NCBI-GeneID: 103002651
NCBI-ProteinID: XP_007180105
LinkDB
Position
Un
AA seq 527 aa
MVSPQMPQFLSPTVILALFFLPQTRPAGVFELQIHSFGPGPGPGAPRSPCKAGDTCRLFF
RVCLKPGISEEAAESPCTLGAALSARGPVYTAQPGAPAPDLPLPDGLMRVPFRDAWPGTF
SLIIETWREELGEQIGGPAWSLLARRFSYRARCEPPAVGAACARLCRSRGAPSRCGPELR
PCPQIEDKCEAPPACRAGCSPEHGFCEQPDECRCLEGWTGPLCTIPVSTSSCLSPRGPSS
ATTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGG
LCVGGADPDSAYICRCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRSGFAG
PRCEHDLDDCANRACANGGTCLEGYAHFSGLVCACAPGYMGARCEFPVHPDGAGALPVAP
PGLRPGDPQRFLLPPALGLLVAAGLAGSALLLVHVRRRGPGRDTGSRLLAGTPEPSVHAL
PDALNNMRTREGAGNGPSPSSDWNRPEDGDARSVYVISAPCIYAREA
NT seq 1584 nt   +upstreamnt  +downstreamnt
atggtctccccgcagatgccccagttcctctccccgacggtgatcctggcgctctttttc
cttccccagacacggccggccggcgtcttcgagctgcagatccactctttcgggccggga
ccaggcccgggcgccccgcggtccccctgcaaggccggggacacctgccgtctcttcttc
agggtctgcctgaagccagggatctccgaggaggccgccgagtctccgtgcaccctgggc
gcggcgctgagtgcgcgcggaccggtctacactgcgcagcccggagcgccagcgcctgac
ttgccgctgccggacggcctcatgcgcgtgcccttccgggacgcctggccgggcaccttc
tctctcatcattgaaacctggagagaggagttaggagaacagattggagggcccgcttgg
agcctgctggcgcgccgcttctcctaccgcgcgcgctgcgagccgccggccgttggggcc
gcgtgcgcgcgcctctgccgctcgcgcggcgccccctcgcggtgtggcccggaactgcgc
ccctgcccgcagattgaggacaaatgcgaggcaccgccggcatgtcgagcaggctgcagc
ccagagcacggcttctgtgagcagcccgatgaatgtcgatgcctggagggctggactggg
cccctctgcacaatccctgtctccaccagcagctgcctcagccccaggggcccatcctct
gccactactggatgcctcgtacccgggcctgggccctgtgatgggaatccgtgtgccaac
ggaggcagttgtagtgagaccccagggtccttcgaatgcacctgtccccgtgggttctac
gggttgcggtgtgaggtgagcggggtgacatgtgcggatggaccttgcttcaacggcggc
ttgtgtgtgggaggtgcggaccccgactctgcctacatctgccgttgcccacccggtttc
caaggctccaattgtgagaagagggtggaccggtgcagcctgcagccgtgccggaatggc
ggactctgcctggatctgggccacgccctgcgctgccgctgccgctccggcttcgcgggg
ccgcgctgcgagcacgacctggatgactgcgccaaccgcgcctgcgccaacggcggcacc
tgcctggagggctacgcgcacttttccggcctcgtctgcgcctgcgcgcccggctacatg
ggcgcgcggtgcgagttcccggttcaccctgacggcgcaggcgcgttgcctgtggccccg
ccgggtctgaggccgggggacccgcagcgcttccttttgccaccggctttgggactgctg
gtggccgcgggcttggccggctctgcgctcttgctggtccacgtgcgacgccgtggccct
ggccgggatactgggtctcgcttgctggcggggaccccggagccatcggtccacgcgctc
cctgatgcactcaacaacatgaggacgcgggaaggtgccgggaatggcccgagcccgtcc
tcagattggaatcgccctgaagatggagacgctcgttcggtttacgtcatatctgctcct
tgtatctatgctcgggaggcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008745
Entry
103008745         CDS       T03086                                 

Gene name
DLL4
Definition
(RefSeq) delta like canonical Notch ligand 4
  KO
K06051  delta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103008745 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103008745 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103008745 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    103008745 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103008745 (DLL4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Other DBs
NCBI-GeneID: 103008745
NCBI-ProteinID: XP_007180444
UniProt: A0A383ZZS4
LinkDB
Position
Un
AA seq 685 aa
MAAATRSASGWALLLLVALWQERAAGSGVFQLQLQEFANERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGHCTFGSVSTPVLGTNSFAVGDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSPLTRLRYSYRVICSDNYY
GDSCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGEYCEQPVCLSGCHEQNGYCSKPAECI
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDSYRCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGTSYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPNRMCRCRPGFTGAHCEIHISDCARSPCVHGGTCRNLENGFACTCPAGFSGRRCEVRMP
TDACASGPCFNGATCYAGLPPDNFVCNCPYGFVGSRCEFPMSMPPSFPWVAVSLGVGLVV
LLVLLCMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGILPGKYPHSDKSLGEKAPLRIHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggcagccgcaacccgtagcgcctctggctgggcgctactgctgctggtggcactttgg
caggagcgcgcggccggctcgggagtcttccagctgcagctgcaggagtttgccaacgag
cgcggcgtactcgccagcgggcggccgtgcgaacccggctgccggaccttcttccgcgtc
tgcctcaagcacttccaggcggtcgtctcgcccgggcactgcaccttcggcagcgtctcc
acgcctgtgctgggcaccaactccttcgccgtcggcgacgacagtagcggcgggggacgc
aaccctctccaactgcccttcaatttcacctggccgggtaccttctcactcatcattgaa
gcttggcacgcgccaggagacgacctgcggccagaggccttgccaccagacgcgctcatc
agcaagatcgccatccagggctccctagctgtgggccagaactggttactggatgagcag
accagccctctcacaaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggggacagctgctcacggctatgcaagaagcgcaatgaccacttcggccactacgtgtgc
cagccagatggcagcctgtcctgcctgcccggctggactggggagtactgcgaacagcct
gtctgtctttcgggctgtcatgaacagaatggctactgcagcaagccagcagagtgcatc
tgccgcccaggctggcagggccgcctgtgcaatgaatgcatcccccacaacggctgtcgc
catggcacctgcagcaccccctggcaatgcacttgtgatgaggggtggggaggcctattc
tgtgaccaagatctcaactactgcacccatcattccccgtgcaagaatggggcaacgtgc
tccaacagtgggcagcggagctatacctgcacctgtcgcccaggctacactggcgtggac
tgtgagctggagctcagcgagtgtgacagcaacccctgtcgcaatggaggcagctgtaag
gaccaggaggacagctaccgctgcctgtgtcccccgggctactatggcctgcactgcgaa
cacagcaccttgagttgtgccgactctccctgcttcaatgggggctcctgtagggagcgc
aaccaggggaccagctatgcctgtgaatgtccccccaacttcactggctccaactgcgag
aagaaagtggacaggtgtaccagcaatccatgtgccaatgggggccagtgcctgaaccga
ggtccaaaccgcatgtgccgctgccgtcctggattcacaggcgcccactgtgaaatccac
atcagcgactgtgcccgcagcccttgtgtccacggcggcacttgccgcaacctggagaac
gggttcgcgtgcacctgccctgctggcttctctggccggcgctgcgaggtgcggatgccc
accgacgcctgtgcctcgggaccctgcttcaacggggccacctgctacgccggcctcccc
ccggacaacttcgtctgcaactgcccctacggctttgtgggcagccgctgcgagttcccc
atgagcatgccccccagcttcccctgggtggccgtctccctgggcgtgggactggtggtg
ctgctggtgctactgtgcatggtggcagtggcggtgcggcagctgcggctcaggcggccc
gacgacggcagcagggaggccatgaacaacctgtcggacttccagaaggacaacctgatc
cccgccgcccagctcaagaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacaacagaaccacacattggactataatctggccccaggg
cccctggggcgggggatcctgcctgggaagtatccccacagtgacaagagcttaggggag
aaggcgccactgcggatacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggactccatgtaccagtctgtgtgtttgatatcagaagagaggaacgaatgtgtc
attgccacagaggtataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017665
Entry
103017665         CDS       T03086                                 

Gene name
DLL1
Definition
(RefSeq) delta like canonical Notch ligand 1
  KO
K06051  delta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04330  Notch signaling pathway
bacu04658  Th1 and Th2 cell differentiation
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    103017665 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103017665 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017665 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    103017665 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103017665 (DLL1)
SSDB
Motif
Pfam: EGF MNNL hEGF DSL EGF_2 EGF_CA EGF_3 cEGF FXa_inhibition ECSCR
Other DBs
NCBI-GeneID: 103017665
NCBI-ProteinID: XP_007186098
UniProt: A0A384AFJ6
LinkDB
Position
Un
AA seq 719 aa
MGRRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGTGADPAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYFGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGQYCTEPICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDQCIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCKN
GATCTNTGQGSYTCSCRPGYTGANCETEVDECSASPCRNGGSCTDLENSYSCTCPPGFYG
RICELSAMVCADGPCFNGGRCSDNPKGGYTCRCPGGFSGFNCEKKMDSCSSSPCSNGAQC
VDLGDAYVCRCQAGFSGRHCDDNLDDCASSPCANGGTCRDGANEYSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERALRYLCECARGYGGPNCQFLLPPGPVVVDLTEQFAEGQAGP
FPWVAVGAGVVLVLTLLLGCAAAVVCVRLRLQKRRPPADPCPAEAETMNNLANRQREKDI
SVSVIGAAQIKNTNKKVDLHTEPGTEKNSLKACDPAVGYKLLQGLKGAAATGEPPSKRDA
KCQPQGSAGEEKSAPTLRGGEAAERKRPDSVYSTSKDTKYQSVYVISEEKDECVIATEV
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgggccggcggtgcgccctggccctcgccgtgctctcggccctgctgtgccaggtctgg
agctccggggtgttcgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcgggggcgcggggccgccgccgtgcgcctgcaggactttcttc
cgcgtgtgcctcaagcactaccaggccagcgtgtcccccgagcctccctgcacctacggc
agcgccgtcacgccggtgctgggcgtcgactctttcagcctcccggacggcacgggcgcg
gaccccgccttcagcaaccccatccgcttcccctttggcttcacctggccgggaaccttc
tctctgatcattgaagctctccacactgattctcctgatgacctcgcaacagagaacccg
gaaagactcatcagccgcctggccacgcagaggcacctgacggtgggcgaggagtggtcc
caggacctgcacagcagcggccgcacagacctcaagtattcctaccggtttgtgtgtgac
gaacactactttggggagggctgctccgtcttctgccgcccccgcgacgacgccttcggc
cacttcacctgcggggagagaggggagaaagtctgcaaccctggctggaaaggccagtac
tgcactgagcccatctgcttgccggggtgcgatgagcagcatgggttttgtgacaagccc
ggggaatgcaagtgcagagtgggctggcagggccggtactgtgaccagtgcattcggtac
cccggctgtctccacggcacctgccagcagccctggcaatgcaactgccaggaaggctgg
ggcggccttttctgcaaccaggacctgaactactgcacacaccataagccctgcaagaat
ggggccacctgcaccaacacgggccagggaagctacacttgctcttgccggcctgggtac
acgggggccaactgcgagacggaggtggacgagtgcagtgccagcccctgcaggaatgga
gggagctgcacggacctcgagaacagctactcctgcacctgcccgcctggcttctacggc
aggatctgcgagctgagtgccatggtgtgcgccgacggcccctgcttcaacgggggacgg
tgctcggacaaccccaagggagggtacacctgccgctgccctgggggcttctctggcttt
aactgtgagaagaaaatggattcctgcagttcctcaccctgttccaatggtgcacagtgc
gtagaccttggcgatgcttacgtctgccgctgccaggccggcttctctgggaggcattgt
gatgacaacctggacgactgtgcctcttccccgtgtgccaacggcggcacctgccgggac
ggcgcgaatgagtattcctgcacctgcccccccgggtacacgggcaggaactgcagcgcc
cccgtcagcaggtgtgagcacgcgccctgccacaacggggccacctgccacgagcgggcc
ctccgctacctgtgcgagtgcgcccgaggctacgggggccccaactgccagttcctgctg
cccccgggccccgtggtggtggacctcaccgagcagttcgcggagggccaagccggcccg
ttcccctgggtggccgtcggcgcgggcgtggtcctcgtcctcacgctgctcctgggctgc
gccgccgccgtggtctgcgttcggctgaggctgcagaagcgccggccgcccgccgacccc
tgcccggcggaggcggagaccatgaataacctggccaaccgccagcgggagaaggacatc
tctgtcagcgtcatcggggccgcgcagatcaagaacaccaacaagaaggtggacctccac
acggagcccggcaccgagaagaacagcctcaaggcttgcgaccccgccgtgggctataag
ctgctgcagggcctcaagggtgccgctgccaccggggagccccccagcaagcgtgatgcc
aagtgccagccccagggctctgcgggggaggagaagagcgccccgaccctccggggtgga
gaagcagctgaaagaaaaaggccggactctgtgtactccacttcgaaagacacaaagtac
cagtcggtgtacgtcatatccgaggagaaggacgagtgtgtcatcgcaactgaggtgtaa

DBGET integrated database retrieval system