KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003003
Entry
103003003         CDS       T03086                                 

Gene name
BCL2L11
Definition
(RefSeq) BCL2 like 11
  KO
K16341  Bcl-2-like protein 11
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04215  Apoptosis - multiple species
bacu04932  Non-alcoholic fatty liver disease
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103003003 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    103003003 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103003003 (BCL2L11)
   04215 Apoptosis - multiple species
    103003003 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003003 (BCL2L11)
   05206 MicroRNAs in cancer
    103003003 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103003003 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103003003 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    103003003 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103003003 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N
Other DBs
NCBI-GeneID: 103003003
NCBI-ProteinID: XP_007197434
UniProt: A0A384BDS9
LinkDB
Position
Un
AA seq 196 aa
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMV
ILRLLRHIIRLVWRMQ
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttccgatgtaagttctgagtgtgacagagaaggtggacaattgcag
cctgccgaaaggcctcctcagctcaggcctggggcccccatctctctacagacagagcgg
caaggtaatcccgaaggagaaggggaccgctgcccccaaggcagcccgcagggcccactg
gccccaccggccagtcccggccctttcgctaccagatccccgcttttcatcttcgtgaga
agatcttccctgctgtctcgatcctccagtgggtatttctcttttgacacagacaggagc
ccggcacccatgagttgtgacaaatcaacacaaaccccaagtcctccttgccaggccttc
aaccattatctcagtgcgatggcttccatgaggcagtctcaggctgtacctgcagatatg
cgtccggagatatggattgcgcaagagttgcggcgtattggagacgaatttaatgcatat
tacccaaggagggtctttctgaataatcaccaagcagccgaaggtcacccgcaaatggtt
atcttacgactgttacgccacatcatccgtctggtgtggaggatgcagtga

DBGET integrated database retrieval system