KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003182Help
Entry
103003182         CDS       T03086                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00480  Glutathione metabolism
bacu00980  Metabolism of xenobiotics by cytochrome P450
bacu00982  Drug metabolism - cytochrome P450
bacu00983  Drug metabolism - other enzymes
bacu01524  Platinum drug resistance
bacu05200  Pathways in cancer
bacu05204  Chemical carcinogenesis
bacu05225  Hepatocellular carcinoma
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103003182 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103003182 (MGST2)
   00982 Drug metabolism - cytochrome P450
    103003182 (MGST2)
   00983 Drug metabolism - other enzymes
    103003182 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    103003182 (MGST2)
   05204 Chemical carcinogenesis
    103003182 (MGST2)
   05225 Hepatocellular carcinoma
    103003182 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103003182 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    103003182 (MGST2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103003182 (MGST2)
Transporters [BR:bacu02000]
 Other Transporters
  Pores ion channels [TC:1]
   103003182 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 103003182
NCBI-ProteinID: XP_007172995
LinkDB All DBs
Position
Un
AA seq 80 aa AA seqDB search
MAGNSILLAALSVLSACQQSYFALQVGKARSKYKVTPPAVSGSPEFERLFRAQQNCVEFY
PIFMITLWMARWYFNQVFDT
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaattcgattttactggctgctctctctgtcctctctgcctgtcagcaaagt
tatttcgctttgcaggtaggaaaggcgagatcaaaatacaaagttacacccccagcagtc
tctgggtcaccagaatttgagagactatttcgtgcacaacaaaactgtgtggagttttac
ccaatatttatgattacattgtggatggcgcgatggtatttcaaccaagtttttgatact
tag

DBGET integrated database retrieval system