KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003452
Entry
103003452         CDS       T03086                                 

Gene name
FHIT
Definition
(RefSeq) fragile histidine triad
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00230  Purine metabolism
bacu01100  Metabolic pathways
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103003452 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103003452 (FHIT)
   05223 Non-small cell lung cancer
    103003452 (FHIT)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     103003452 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C OTCace_N
Other DBs
NCBI-GeneID: 103003452
NCBI-ProteinID: XP_007192425
UniProt: A0A384AZE5
LinkDB
Position
Un
AA seq 171 aa
MHPAVERSEEVTVFRENSNREEMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLV
CPLRPVERFRDLRPNEVADLFQAAQRVGTAVEKHFQGTSLTFSVQDGPEAGQTVKHVHIH
VLPRKAGDFHRNDSIYDELQKHDKEKEDSPTLWRSEEEMAAEAAALRGYFQ
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcaccctgctgttgagcgctctgaggaggtaacagtattcagagagaattcaaaccgt
gaggaaatgtcattcagattcggccaacatctcatcaagccctctgtggtgtttctcaaa
acagaactgtccttcgccctggtgaacaggaaacctgtggtacctggacatgtcctcgtg
tgtcccctccggccagtggagcgcttccgagacctgcgtcccaatgaagtggccgacctg
tttcaggcagcacagagagtcgggacggcggtggagaagcatttccagggcacctctctc
accttttctgtgcaggatggccccgaagccggacaaactgtgaagcatgttcacatccac
gttctcccaaggaaggctggagactttcacaggaatgacagcatctatgatgagctccag
aaacatgacaaagagaaggaggactccccaaccttgtggagatcggaggaggagatggca
gccgaagctgcggcgctgcggggctactttcagtga

DBGET integrated database retrieval system