KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003545Help
Entry
103003545         CDS       T03086                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00480  Glutathione metabolism
bacu00980  Metabolism of xenobiotics by cytochrome P450
bacu00982  Drug metabolism - cytochrome P450
bacu00983  Drug metabolism - other enzymes
bacu01524  Platinum drug resistance
bacu05200  Pathways in cancer
bacu05204  Chemical carcinogenesis
bacu05225  Hepatocellular carcinoma
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103003545 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    103003545 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    103003545 (GSTO1)
   00983 Drug metabolism - other enzymes
    103003545 (GSTO1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    103003545 (GSTO1)
   05204 Chemical carcinogenesis
    103003545 (GSTO1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    103003545 (GSTO1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    103003545 (GSTO1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    103003545 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bacu02000]
    103003545 (GSTO1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103003545 (GSTO1)
Transporters [BR:bacu02000]
 Other Transporters
  Pores ion channels [TC:1]
   103003545 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin Corona_S2
Motif
Other DBs
NCBI-GeneID: 103003545
NCBI-ProteinID: XP_007172147
UniProt: A0A383ZAQ3
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MSGGSARSLGKGSAPPGPVPEGLIRVYSMRFCPFAKRTLLVLKAKGIGHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQVIYESAITCEYLDEAYPGKKLLPDDPYEKACQKMVFELF
SKVPPLLLSFLRRQNKEDCSGVKEELHKEFSKLEEVLTNKKTTFFGGSSLSMIDYLIWPW
FEWLIALELNECVDHTPNLKLWMEAMMKDPAVSSLFIDPKAFRGFLDLYLQNNLEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaggatcagccaggagcctggggaagggaagcgcgcccccggggccggtcccc
gagggcctgattcgcgtctacagcatgaggttctgcccgttcgccaagaggacgctcctg
gtcctgaaggccaagggaattgggcatgaagtcattaacatcaacctaaaaaataagcct
gagtggttcttcaagaagaatccctttggcctggtgccagttctggaaaacagtcagggt
caagtgatctacgaatctgccatcacttgtgagtacctggatgaagcatatccaggaaag
aagctgttgccagatgacccctatgagaaagcttgccaaaagatggtctttgagttgttt
tctaaggtaccacctttgttattaagctttcttagaaggcaaaataaggaagactgctct
ggcgtgaaagaagaattgcataaagaattcagcaagctagaggaggttctgactaataag
aagacaaccttctttggtggcagctctctttctatgattgattacctcatctggccctgg
tttgaatggctgatagccctggagttaaatgaatgtgtagaccacactccaaatcttaag
ctctggatggaagccatgatgaaagatcctgcagtatcatccctcttcattgatccaaag
gcctttcgaggtttcttagatctctacttgcagaacaacctcgaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system