KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003614
Entry
103003614         CDS       T03086                                 

Definition
(RefSeq) uncharacterized LOC103003614
  KO
K10785  T-cell receptor beta chain V region
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04514  Cell adhesion molecules
bacu04612  Antigen processing and presentation
bacu04658  Th1 and Th2 cell differentiation
bacu04659  Th17 cell differentiation
bacu04660  T cell receptor signaling pathway
bacu04672  Intestinal immune network for IgA production
bacu04940  Type I diabetes mellitus
bacu05135  Yersinia infection
bacu05142  Chagas disease
bacu05144  Malaria
bacu05150  Staphylococcus aureus infection
bacu05162  Measles
bacu05166  Human T-cell leukemia virus 1 infection
bacu05169  Epstein-Barr virus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05202  Transcriptional misregulation in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
bacu05310  Asthma
bacu05320  Autoimmune thyroid disease
bacu05321  Inflammatory bowel disease
bacu05322  Systemic lupus erythematosus
bacu05323  Rheumatoid arthritis
bacu05330  Allograft rejection
bacu05332  Graft-versus-host disease
bacu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103003614
   04015 Rap1 signaling pathway
    103003614
   04064 NF-kappa B signaling pathway
    103003614
   04020 Calcium signaling pathway
    103003614
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103003614
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    103003614
   04660 T cell receptor signaling pathway
    103003614
   04658 Th1 and Th2 cell differentiation
    103003614
   04659 Th17 cell differentiation
    103003614
   04672 Intestinal immune network for IgA production
    103003614
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    103003614
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103003614
  09163 Immune disease
   05310 Asthma
    103003614
   05322 Systemic lupus erythematosus
    103003614
   05323 Rheumatoid arthritis
    103003614
   05320 Autoimmune thyroid disease
    103003614
   05321 Inflammatory bowel disease
    103003614
   05330 Allograft rejection
    103003614
   05332 Graft-versus-host disease
    103003614
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103003614
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    103003614
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103003614
   05150 Staphylococcus aureus infection
    103003614
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103003614
   05170 Human immunodeficiency virus 1 infection
    103003614
   05162 Measles
    103003614
   05169 Epstein-Barr virus infection
    103003614
  09174 Infectious disease: parasitic
   05144 Malaria
    103003614
   05142 Chagas disease
    103003614
SSDB
Motif
Pfam: V-set Ig_3 Ig_5
Other DBs
NCBI-GeneID: 103003614
NCBI-ProteinID: XP_007184944
LinkDB
Position
Un
AA seq 263 aa
MGNQVICCVALCLLGAGTVDGGVTQTPKYLFKVEGRDVTLKCEQDFDYDVMYWYRQDPGQ
GLRLIYYSQIVKDVRKGDIAEGYSASREKKSLFPLTLTSTQKNQTALYLCAANIDTSLCL
ELYKYLVLAMGSWTFCYVALCLLGAGPMDAEIYQMRFVLAEAGRDVTLECKQALSYNAMY
WYRQDAGQGLRLIYYSTVEKDVQRGDISEGYSVSREEKGLFPLTVKAAHTNQTALYLCAG
SVTVEHGHTTPVHKPAPALQLPI
NT seq 792 nt   +upstreamnt  +downstreamnt
atgggcaaccaggtgatctgctgtgtggccctttgtctcctcggagcaggcactgtggat
ggcggggtcactcagaccccaaaatacctgttcaaagtggaaggacgagatgtgaccctg
aaatgtgaacaggattttgattacgacgtcatgtactggtaccgacaggacccaggacaa
gggctgagactgatctactactctcaaattgtaaaggatgttcggaaaggagacatagct
gaaggatacagtgcctcccgggagaagaagtccctctttcctctcaccttgacatcgaca
caaaagaaccagacggctctctatctctgtgccgctaatatagacaccagtctgtgtctg
gagctttacaaatacctagtccttgccatgggtagctggaccttctgctacgtggccctt
tgtcttctgggagcaggacccatggatgctgaaatctaccagatgagattcgtgctcgct
gaggctggacgggatgtgaccctggagtgtaaacaggctctgagctacaacgccatgtac
tggtaccggcaggatgcagggcagggtctgaggctgatttactactctacggttgaaaag
gatgttcagagaggagacatatctgaaggctacagtgtctctcgagaggagaaggggctg
tttcctctcactgtgaaggcggctcacaccaaccaaacagccttgtacctctgtgctggt
agcgtcacagtggagcacggccacaccacacctgtgcacaaacccgctccagccctgcag
ctcccaatatag

DBGET integrated database retrieval system