KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003673
Entry
103003673         CDS       T03086                                 

Gene name
LRP6
Definition
(RefSeq) LDL receptor related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05200  Pathways in cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103003673 (LRP6)
   04150 mTOR signaling pathway
    103003673 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103003673 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003673 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103003673 (LRP6)
   05226 Gastric cancer
    103003673 (LRP6)
   05224 Breast cancer
    103003673 (LRP6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103003673 (LRP6)
   05022 Pathways of neurodegeneration - multiple diseases
    103003673 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103003673 (LRP6)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103003673 (LRP6)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Other DBs
NCBI-GeneID: 103003673
NCBI-ProteinID: XP_007196121
LinkDB
Position
Un
AA seq 1461 aa
MYWTDWGEVPKIERAGMDGSSRFIIINTEIYWPNGLTLDYEERKLYWADAKLNFIHRSNL
DGTNRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILACNKYTGEGLREIHSNIFSPMDI
HAFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCACPTGVKLLENGKTCKDGATELL
LLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDPVEGYIYWTDDEVRAIRRSFIDG
SGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTMRKILISEDLEEPRAI
VLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSLGWPNGLALDYDEGKIYWGDAKT
DKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREIIIDQ
LPDLMGLKATNVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFELISDMKTCIVPE
AFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWTDISLKTISRAFM
NGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHRQVLVWKDLDSPR
ALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPNVGRANGLTIDYAKRRLYWTDLD
TNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERANKTSGQNRTIIQG
HLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAHYSLNADNRTCSA
PTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQLYWIDSRQNMIRK
AQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIYWTCEATNVINVTRLDGRSIGVV
LKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDS
RLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYWIDKQQQMIEKID
MTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCTQDNGGCSHICLVKGDGTTRCSCP
MHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVAWRCDGFTECEDHSDELNCPVCSES
QFQCASGQCIDGALRCNGDANCQDKSDEKSCEVLCLIDQFRCANGQCIGKHKKCDHNLDC
SDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLCPRMKGDGETMTN
DYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPPYDRAHVTGASSS
SSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYRPHSYRHFAPPTTPCS
TDVCDSDYAPSRRIMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPY
TERSYPHHLYPPPPSPCTDSS
NT seq 4386 nt   +upstreamnt  +downstreamnt
atgtactggacagactggggagaagtaccaaagatagaacgtgctggaatggatggttca
agtcgcttcattataataaacactgaaatttactggccaaatggactgactttggattat
gaggaacggaagctttattgggcagatgcaaaacttaatttcatccacagatcaaatctg
gatggaacaaatcggcaggcggtggttaaaggttcccttccacatccttttgccttgacg
ttatttgaggacacattgtactggactgactggaatacacactccattttggcttgcaac
aagtacactggcgagggtctgcgtgaaatccattctaacatcttttctcccatggatata
catgccttcagccagcagaggcagccaaatgctacaaatccatgtggaattgataatggt
ggttgttcccacttgtgtttgatgtctccagtcaagcctttttatcagtgtgcttgccca
actggggttaaactcctggagaatggaaaaacctgcaaagatggtgccactgaattactg
cttttagcccgaaggacagatttgagacgaatttctttggatacaccagatttcacagac
attgttctacagttggaagacatccgtcatgccattgccatagattatgatcctgtggaa
ggctatatctactggactgatgatgaagtgagggccatacgccgctcattcatagatgga
tctggcagtcagtttgtggtcactgctcaaatcgcccatcctgatggtattgctgttgat
tgggttgcccgaaatctttattggacagacactggcactgatcggatagaagtgacaagg
ctcaacgggaccatgaggaagatcttgatttcagaggacttagaggaaccccgggctatt
gtgttagatcccatggttgggtacatgtattggactgactggggagaaatcccgaaaatt
gagcgagcagctctggatggttctgatcgagtagtgttggttaacacttctcttggttgg
ccaaatggtttagccttggattatgatgaaggcaaaatatactggggagatgccaaaaca
gacaaaattgaggttatgaataccgatgggactgggagacgagtgctagtggaagacaaa
attccccacatatttgggtttactttgttgggtgactatgtttactggactgactggcag
aggcgtagcatcgaaagagtacacaaacgaagtgcagagcgggaaatcatcatagaccag
ctccctgacctcatgggcctgaaggccacaaatgttcatcgaatcattggttccaacccc
tgcgccgaggagaatgggggatgcagccatctctgcctctatagacctcagggccttcgc
tgtgcctgccccattggctttgaactcatcagtgacatgaagacctgcatcgtcccagag
gctttccttttgttttcacggagagcagatatcaggagaatttctttggaaactaacaat
aataatgtggccatcccgctcactggtgtcaaagaagcttctgctttggattttgatgtg
acagacaaccgaatatactggactgacatatcactcaagaccatcagcagagcctttatg
aatggcagtgcactggaacatgtggtagaatttggcttagattatccagaaggcatggca
gtagactggcttgggaagaacttgtactgggcagacacaggaacaaatcgaattgaggta
tcaaagttggacgggcagcaccgacaagttttggtgtggaaagacctagatagtcccaga
gctcttgcattggaccccgctgaaggatttatgtattggactgaatggggtggaaagcct
aagatagacagagctgccatggatggaagtgaacgtactacattagttccaaatgtgggg
cgagcaaatggcctaactattgattatgctaaaaggaggctttattggacagacctggac
accaacttaatagaatcttcaaatatgcttggactcaaccgtgaggttatagcagatgac
ttgcctcatccttttggcttaactcagtaccaagattacatctactggacggactggagc
cgacgcagcatcgagcgtgccaacaaaaccagtggccaaaaccgcaccatcattcagggc
catttggattatgtgatggacatcctcgtgtttcactcctctcggcaggcagggtggaat
gagtgtgcttccagcaatgggcactgctcccacctctgcttggcagtgccagttggaggt
tttgtttgtggatgccctgcccactactctcttaatgctgacaacaggacttgtagtgct
ccaactactttcctgctcttcagtcaaaagagtgccatcaaccgcatggtgattgatgaa
cagcagagccccgacatcatccttcctatccacagccttcggaatgtccgggccattgac
tatgacccactggacaagcagctctattggattgactcacgacaaaacatgatccgaaaa
gcacaagaagatggcagccagggctttactgtggttgtgagctcagttccgaatcagaac
ctagaaatacagccctatgacctcagcattgatatttatagccgctacatctattggact
tgcgaagccaccaatgtcattaatgtaacaagattagatgggagatcgattggagtggtg
ttaaaaggcgagcaagacagacctcgagccattgtggtaaacccagaaaaagggtatatg
tattttaccaatcttcaggaaaggtctcccaaaattgaacgagctgctttagatggaaca
gaacgggaagtcctctttttcagtggcttaagtaaaccaattgctttagctcttgatagc
agattgggcaaactcttttgggctgattcagatctccggcgaattgaaagcagtgatctc
tcaggtgccaaccggatagtattagaagactccaacattctgcagcctgtgggactaact
gtgtttgaaaactggctatattggattgataagcagcagcagatgattgaaaaaattgac
atgacaggtcgagagggtagaaccaaagtccaggctcgaattgcccagcttagtgacatt
catgctgtaaaggagctgaatcttcaggaatatagacagcacccttgtactcaggataat
ggtggctgttcacatatttgtcttgtaaagggagatggtactacaaggtgctcctgcccc
atgcacttggttctgcttcaagatgagctactatgtggagaacccccaacatgttctcct
cagcagtttacttgtttcacgggagaaattgactgtatccctgtggcttggcggtgcgat
gggtttactgagtgtgaagatcacagtgatgagctcaattgtcctgtgtgctcagagtcc
cagttccagtgtgccagtgggcagtgtattgacggtgccctgagatgcaatggagatgcc
aactgccaggataagtcagatgagaagagctgtgaagtgctttgtttaattgatcaattc
cgctgcgccaatggtcagtgcattggaaaacacaagaaatgtgatcataatttagattgc
agcgacaaatcagatgaactggattgttatccaactgaggagccagcaccacaggccacc
aatacagttggttcagttattggagtaattgttaccatttttgtgtctggaaccatatac
tttatttgccagaggatgttgtgtccacgtatgaagggcgatggggaaaccatgactaat
gactatgtagttcatggaccagcttctgtgccccttggttatgtgccacacccaagctct
ttgtcaggatctcttccaggaatgtctcgaggtaaatcaatgataagctccctcagtatc
atggggggaagcagtggacccccttatgaccgagctcatgtcacgggagcatcgtccagt
agttcttcaagcaccaaaggcacttacttccctgcaattttgaaccctccgccatcccca
gccacagagcgatcacattacactatggaatttggttattcttcaaacagtccttccact
cataggtcctacaggccgcacagttaccggcactttgcaccgcccaccacaccctgcagc
acagatgtttgtgacagtgactacgctcccagccggagaataatgacctcagtggccaca
gccaagggctacactagtgacttgaactatgactcagagcctgtgcctccgcctcccacg
ccccgaagccagtacttgtcggcagaagagaactatgaaagctgcccgccttctccatac
acagagaggagctaccctcatcacctctacccaccgccgccctctccctgtacggactcc
tcctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103011202
Entry
103011202         CDS       T03086                                 

Gene name
LRP5
Definition
(RefSeq) LDL receptor related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04150  mTOR signaling pathway
bacu04310  Wnt signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05200  Pathways in cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103011202 (LRP5)
   04150 mTOR signaling pathway
    103011202 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    103011202 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103011202 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103011202 (LRP5)
   05226 Gastric cancer
    103011202 (LRP5)
   05224 Breast cancer
    103011202 (LRP5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103011202 (LRP5)
   05022 Pathways of neurodegeneration - multiple diseases
    103011202 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103011202 (LRP5)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    103011202 (LRP5)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition DUF5050 Ldl_recept_a SGL EGF Insulin_TMD
Other DBs
NCBI-GeneID: 103011202
NCBI-ProteinID: XP_007171328
LinkDB
Position
Un
AA seq 1688 aa
MPSDPIAQMSKLRLGEPEDLSGSYRDRRTGVSSSRARVSPHPKTCLSIFAVALGRFREPG
RPGAVEPKWPLGLCFRPPSPISTCTATAMEEASPSRLAATGHSRRGSSWQLHVWASPLLL
FANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTG
AAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAI
ALDPAHGYMYWTDWGEIPRIERAGMDGSTRKVIVDSDIYWPNGLTIDLEEQKLYWADAKL
SFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGDKRKEILS
ALYSPMDIQVLSPERQPYYHTRCEENNGGCSHLCLLSPREPFYACACPTGVQLQDDGQTC
KAGAEEVLLLARRTDLRRISLDMPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTDDEVRA
IRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSE
DLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGQERHVLVNTSLGWPNGLALDLQEGK
LYWGDAKTDKIEVINIDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKA
SRDVIIDQLPDLMGLKAVNVAKAVGTNPCADRNGGCSHLCFFTPRAAKCGCPIGLELLSD
MKTCIVPEAFLVFTSRAAIHRISLDTNNNDVAIPLTGVKEASALDFDVSNHHIYWTDVSL
KTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLV
WRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQ
RLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADKTSG
RNRTLIQGHLDFVMDILVFHSSRQDGLNDCMHNNGQCGQLCLAVPSGHRCSCASHYTLDP
SSRNCSPPTAFLLFSQKCAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDG
RQNIKRAKDDGTQPFVLTSPSQSQNPDRQPHDLSVDIYSRTLFWTCEATDTINVHRLNGD
AMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIRPVA
LVVDNMLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQM
IERVDKTTGDARTRVQGRVAHLTGIHAVEDISLEEFSAHPCARDNGGCSHICIAKGDGTP
RCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEEGCP
VCSAAQFPCARGQCPPASLNARPLLAAVCLPNQFRCASGQCVLIKQQCDSFPDCVDGSDE
LMCEITKLPSDDGPAHSSAIGPVIGIILSLFIMGGVYFVCQRVVCQRYAGANGPFPHEYV
SGTPHVPLNFIAPGGSQHGPFTGISCSKSMMSSVSLMGDRAGVPLYDRNHVTGASSSSSS
STKATLYPPILNPPPSPATDPSLYNVDVFYPSSIPATARPYRPYIIRGMAPPTTPCSTDV
CDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPP
PSPCTDSS
NT seq 5067 nt   +upstreamnt  +downstreamnt
atgccatcagaccccatcgcacagatgagcaagctgaggctaggagagcctgaggacctc
tcagggtcgtacagggaccgcaggacgggcgtgtcatcctccagggcccgagtcagtccc
catcccaagacctgtctctccatctttgccgtggccttgggccgcttccgggagcctggc
aggccgggagccgtggaaccgaaatggcccctgggcctctgcttccggccccccagccct
atcagcacctgcacagccactgcgatggaggaagcctctccatcaaggctggcagccact
ggccacagccggaggggctcctcgtggcagctgcatgtatgggcctcgccgctcctcctg
tttgccaaccgccgggacgtacggctggtggacgccggcggagtcaagttggagtccacc
attgtggtcagcggcctggaggatgcggccgcggtggatttccagttctccaagggagcc
gtgtactggacggatgtgagcgaggaggccatcaagcagacctacctgaaccagaccggg
gctgccgtgcagaacgtggtcatctccggcctggtgtcgcccgacggcctggcctgcgac
tgggtcggcaagaagctgtactggacggactcggagaccaatcgcatcgaggtggccaac
ctcaatgggacgtcccggaaggtcctcttctggcaggacctggaccagccgcgggccatc
gccttggaccccgctcatgggtacatgtactggacagactggggagagataccccggatc
gaacgggcagggatggatggcagcacccggaaggttatcgtggactcggacatttactgg
cccaatgggctgaccatcgacctggaggagcagaagctgtattgggcggacgccaagctc
agcttcatccaccgcgccaacctggacggctccttccggcagaaggtcgtggagggcagt
ctgacgcacccttttgccctgacgctctctggagacactctgtactggacagactggcag
acccgctccatccacgcctgtaacaagaggactggagacaagaggaaggagatccttagc
gctctctactcgcccatggatatccaagtgctcagcccagagcggcagccttactaccac
acgcgatgcgaggagaacaacggcggctgctcgcacctatgcctgctgtccccgagggag
cccttctacgcgtgcgcctgccccactggtgtgcagcttcaggacgacggccagacgtgc
aaggcaggggccgaggaggtgctgctcctggcccggcggacggacctgcggaggatctcg
ctggacatgccggacttcacagacatcgtgctgcaggtggacgacatccggcatgccatc
gccatcgactacgacccgctggagggctacgtgtactggacggacgacgaggtgcgtgcc
atccgcagggcgtacctggacgggtcgggggcacagacactggtcaacaccgagatcaac
gaccccgacggcattgcagtcgactgggtggcccgcaacctctattggacggacacgggc
accgaccgcatcgaggtgacgcgcctcaacggcacctcccgcaagatcctggtgtccgag
gacctggacgagccccgcgccatcgtgctgcaccccgtgatgggcctcatgtactggaca
gactggggggagaaccccaaaatcgagtgcgccaacctggacggacaggagcggcacgtc
ctggtcaacacctccctgggctggcccaatggcttggctctggacctgcaggaggggaag
ctgtactggggagacgccaagacggacaaaatcgaggtgatcaacatcgacgggacaaag
aggcggacgctcctggaggacaagctcccccacattttcgggttcacgctgctgggggac
ttcatctactggaccgactggcagcggcgcagcatcgagcgcgtgcacaaggtcaaggcg
agccgggacgtcatcatcgaccagctgcccgacctgatggggctcaaggccgtgaatgtg
gccaaggccgtcgggaccaacccgtgtgcggacaggaacggaggctgcagccacctgtgc
ttcttcacgccccgcgccgccaagtgcggctgccccatcggcctggagctgctgagtgac
atgaagacctgcatcgtccccgaggccttcctcgtgttcaccagccgggccgccatccac
aggatctccctggataccaataacaacgacgtggccatcccgctcacgggcgtcaaggag
gcctctgcgctggacttcgacgtgtccaaccatcacatctactggactgatgtcagcctg
aagaccatcagccgagccttcatgaacgggagctccgtggagcatgtgatcgagtttggc
ctcgactacccggaaggcatggccgtcgactggatgggcaagaacctctattgggcggac
accgggaccaacaggatcgaagtggcccggctggatgggcagttccggcaggtccttgtg
tggagggatctggacaacccgaggtcgctggccctggaccccaccaaaggctacatctac
tggaccgagtggggcggcaagcccaggatcgtgcgggccttcatggacgggaccaactgc
atgacgctggtggacaaggtgggccgggccaacgacctcaccattgactacgccgaccag
cgtctctactggacggacctggacaccaacatgattgagtcatccaacatgctgggtcag
gaacgggtcgtgattgctgatgacctcccgcaccccttcggcctgacgcagtacagcgat
tacatctactggacagactggaacctgcacagcatcgagcgagctgacaagaccagtggc
cggaaccgcaccctcatccagggccacctggatttcgtgatggacatcctggtgttccac
tcctcccgccaggacggcctcaatgactgcatgcacaacaacgggcagtgtgggcagctg
tgcctggctgtccccagcggccaccgctgcagctgtgcctcacattacaccctggacccc
agtagccgcaactgtagcccacccaccgccttcctgctcttcagccagaagtgtgctatc
agccggatgatccctgatgaccagcacagcccagacctcatcctgcccctgcacgggctg
aggaacgtcaaggccatcgactatgacccactggacaagttcatctactgggtggatggg
cgccagaacatcaaacgcgccaaggacgatgggacccagcccttcgttttgacctctccg
agccaaagccagaacccggacaggcagccgcatgacctcagcgttgacatctacagccgg
acgctgttttggacgtgcgaggccaccgacaccatcaacgtccaccggctgaatggggat
gccatgggggtggtgctccgcggggaccgcgacaagccgagggccatcgtcgtcaacgcc
gagcgagggtacctgtacttcactaacatgcaggaccgagcagccaagatagagcgcgcg
gccctggacggcaccgagcgtgaggtcctcttcaccacgggcctcatccgccccgtggcc
ctcgtggtggacaacatgctgggcaagctcttctgggtggatgccgacctgaagcgcatt
gaaagctgcgacctgtcaggggccaaccgcctgaccctggaggacgccaacatcgtgcag
cctgtgggcctgactgtgctgggcaggcacctctactggatcgaccgccagcagcagatg
attgagcgcgtggacaagaccacaggggatgcgcggacacgagtccagggccgtgtcgcc
cacctgaccggcatccacgccgtggaggacatcagcctggaggagttctcagcccaccct
tgtgcccgggacaatggcggctgttcccacatctgcattgccaagggtgatgggacacca
cggtgctcatgcccagtccacctcgtgctcctgcagaacctgttgacttgtggtgagcct
cctacgtgctcccccgaccagttcgcgtgcgccactggggagatcgactgcattcctggg
gcctggcgctgcgacggcttcccggagtgtgacgaccagagcgacgaggagggctgcccg
gtgtgctcggccgcccagttcccgtgtgcgcggggccaatgccctccagcctctctgaac
gcaaggcccctccttgcagccgtctgcctgcccaaccagttccggtgcgccagcggccag
tgcgtcctcatcaagcagcagtgcgattcctttcctgactgcgtcgacggctccgacgag
ctcatgtgcgaaatcaccaagctgccctcggacgacggcccggcccacagcagcgccatc
gggccggtaatcggcatcatcctctcgctcttcatcatgggcggggtctactttgtgtgc
cagcgcgtggtgtgtcagcgctacgccggggccaacgggcccttcccgcatgagtacgtc
agtgggaccccccacgtgcccctcaatttcatcgcccccggcggctcccagcacggtccc
ttcacaggcatttcgtgcagcaagtccatgatgagctccgtgagcctgatgggggaccga
gccggggtgcccctctacgaccggaaccacgtcaccggggcctcgtccagcagctcgtcc
agcaccaaggccacgctgtacccgccgatcctgaacccgccgccgtcccccgccacggac
ccctccttgtacaacgtggacgtgttctacccttccagcattcccgccaccgccaggccg
tacagaccctatatcatccgtggcatggcgccccctacaacgccctgcagcacagacgtg
tgcgacagtgactacagcgccagccgctggaaggccagcaagtactacctggatttgaac
tcggactcagacccctacccacctccgcccacaccccacagccagtacctgtcggcggag
gacagctgcccaccatcgcccgccacggagaggagctatttccacctcttcccaccccct
ccgtccccctgcacggactcgtcctga

DBGET integrated database retrieval system