KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003704
Entry
103003704         CDS       T03086                                 

Gene name
SGK3
Definition
(RefSeq) serum/glucocorticoid regulated kinase family member 3
  KO
K13304  serum/glucocorticoid-regulated kinase 3 [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103003704 (SGK3)
   04151 PI3K-Akt signaling pathway
    103003704 (SGK3)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103003704 (SGK3)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   103003704 (SGK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PX Pkinase_C Kinase-like FTA2 Kdo APH
Other DBs
NCBI-GeneID: 103003704
NCBI-ProteinID: XP_007185071
UniProt: A0A384ACM5
LinkDB
Position
Un
AA seq 490 aa
MDYKESCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSEWFVFRRYAEFDKLYNTLRKQFP
AMALKIPAKRIFGDNFDPDFIKQRRAGLNEFIQNLVRHPELYNHPDVRAFLRMDSPKHQS
DPSEDEDERSTQKLHSTSQNINLGPSGNPHAKPTDFDFLKVIGKGSFGKVLLVKRKLDGK
FYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLHYSFQTTEKLYFVLDFINGG
ELFFHLQRERSFPEHRARFYAAEIASALGYLHSIKIVYRDLKPENILLDSVGHVVLTDFG
LCKEGIAISDTTTTFCGTPEYLAPEVIRKQPYDNTVDWWCLGAVLYEMLYGLPPFYCRDV
AEMYDNILHKPLSLRPGVSLTAWSILEELLEKDRQNRLGAKEDFLEIQNHPFFESLSWTD
LVQKKIPPPFNPNVAGPDDIRNFDAAFTEETVPYSVCVSSDYSIVNASVLEADDAFVGFS
YAPPSEDLFL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggactacaaggaaagctgtccaagtgtaagcattcccagctctgatgaacacagagag
aaaaagaagaggtttactgtttataaagttctggtttcagtgggcaggagtgagtggttt
gtcttcagaagatatgcggagtttgataagctttacaacactttaaggaaacaatttcct
gctatggccctgaagattcctgccaagagaatatttggtgataattttgatccagatttt
attaaacagagaagagcgggactgaatgaattcattcagaacttagttaggcatccagaa
ctttacaaccatccagatgtcagagcattccttcgaatggacagtccaaaacatcagtca
gatccatctgaagatgaggatgaaagaagtactcagaagctacactctacctcacagaac
attaacctgggaccatctggaaatcctcatgctaaaccaacagactttgatttcttaaaa
gttattggaaaaggcagctttggcaaggttcttcttgtaaaacggaaactggatggaaaa
ttttatgctgtcaaagtgttacagaaaaagatagttctcaacagaaaagagcaaaaacac
attatggctgaacgtaatgtgctcttgaaaaatgtgaaacatccatttttggttggatta
cattattctttccaaacaactgaaaagctttattttgttctggattttattaatggaggg
gagctgttttttcacttacaaagagaacggtcctttcctgaacacagagctaggttttat
gctgctgaaattgccagtgcattgggttatttgcactccatcaaaatagtgtacagagac
ttgaaaccagaaaatattcttttggattcagtaggacatgttgtcttaacagattttggg
ctttgtaaagaaggaattgctatttctgacaccacaacaacattttgtgggacaccagag
tacctagcacctgaagtaatcagaaaacagccctatgacaatactgtagattggtggtgc
cttggtgctgttctgtatgaaatgctgtatggattgcctcctttttattgccgagatgtt
gctgaaatgtatgacaatattcttcacaagcccctaagtttgaggccaggagtgagcctt
acagcctggtcaattctggaagaactcctagaaaaagacaggcaaaaccgactcggtgcc
aaagaagacttccttgaaattcagaatcatcctttttttgaatcactcagctggactgat
cttgtacaaaagaagattccaccaccgtttaatcctaatgtggcaggaccagatgatatc
aggaactttgatgcagcgtttacagaagaaacagttccatattccgtgtgtgtgtcttct
gactattccatagtgaacgccagcgtactggaggctgacgacgcttttgttggtttctct
tacgcacctccttcagaagatttatttttgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103013234
Entry
103013234         CDS       T03086                                 

Gene name
SGK2
Definition
(RefSeq) SGK2, serine/threonine kinase 2
  KO
K13303  serum/glucocorticoid-regulated kinase 2 [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103013234 (SGK2)
   04151 PI3K-Akt signaling pathway
    103013234 (SGK2)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103013234 (SGK2)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   103013234 (SGK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C Kdo FTA2
Other DBs
NCBI-GeneID: 103013234
NCBI-ProteinID: XP_007193166
UniProt: A0A384B0D8
LinkDB
Position
Un
AA seq 367 aa
MDSSLAGTPSLQPPRANGNINLGPSANPNARPTDFDFLKVIGKGNYGKVLLAKHKSDGMF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNMCHPFLVGLHYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWSLGAVLYEMLHGLPPFYSQDVS
QMYENILSQPLRIPGGLTVAACDLLQALLHKDQRQRLGSKTDFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVAGPADLKHFDPEFTQEAVSKSIGCTPDTMASSSGASSAFLGFSYAPE
DDAVLDC
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggactctagcctggctgggacccccagtctgcagcccccaagggccaatgggaatatc
aacctggggccttcggccaacccaaatgcccggcccaccgacttcgacttcctcaaagtc
attggcaaaggaaactacgggaaggtcctactggccaagcacaagtctgacgggatgttc
tacgcagtgaaggtgctacagaaaaagtccatcttaaagaagaaagagcagagccatatc
atggcagagcgcagcgtgctcctgaagaacatgtgccaccccttcctcgtgggcctgcac
tactccttccagacgccggagaagctctactttgtgctggactatgtcaacgggggagag
ctcttcttccacctgcagcgggagcgccggttcctggagccccgggcccggttttacgcc
gccgaggtggccagcgccattggctacctgcactccctcaacatcatttacagggacctg
aaaccagagaacattcttttggactgccagggacacgtggtgctgacggattttggcctc
tgcaaggaaggtgtagagcccgaggagaccacgtccacgttttgtgggacccccgagtac
ctggctccagaagtgcttcgtaaagagccttatgatcgggcagtggattggtggtccttg
ggggccgttctctacgagatgctgcacggcctgccgcccttctacagccaagatgtgtcc
cagatgtatgagaacattctgagccagccgctacggatccctgggggcctgacagtggcc
gcctgcgacctcctgcaagcccttcttcacaaggaccagaggcagcggctgggctccaaa
acagactttcttgagataaagaaccatgtattcttcagccccataaactgggacgacttg
taccacaagaggctgactccacccttcaacccaaatgtggcaggacctgctgacttgaaa
cactttgacccagagttcacccaagaagctgtgtcaaagtccattggctgcactcccgac
actatggccagcagttctggggcctcaagtgccttcctgggattttcctatgcaccggag
gatgatgccgtcttagattgctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103016100
Entry
103016100         CDS       T03086                                 

Gene name
SGK1
Definition
(RefSeq) serum/glucocorticoid regulated kinase 1
  KO
K13302  serum/glucocorticoid-regulated kinase 1 [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103016100 (SGK1)
   04151 PI3K-Akt signaling pathway
    103016100 (SGK1)
   04150 mTOR signaling pathway
    103016100 (SGK1)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103016100 (SGK1)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103016100 (SGK1)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  SGK family [OT]
   103016100 (SGK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like PX Kdo
Other DBs
NCBI-GeneID: 103016100
NCBI-ProteinID: XP_007190959
UniProt: A0A384AUZ9
LinkDB
Position
Un
AA seq 526 aa
MVNKDMNGFPVKKCSAFQFFKKRVRRWIKSPMVSVDKHQSPSLKYTGPSVVYVPPGEPDF
EPSLCQTCLGDQAFQRGVLPQENESSSWETQSGCEVKEPCNHANILSKPDPRTFWTNDDS
AFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINL
GPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAEEAFYAVKVLQKKAILKKKEEKHIMS
ERNVLLKNVKHPFLVGLHFSFQTADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAAE
IASALGYLHSLNIVYRDLKPENILLDSQGHIVLTDFGLCKENIEHNGTTSTFCGTPEYLA
PEVLHKQPYDRTVDWWCLGAVLYEMLYGLPPFYSRNTAEMYDNILNKPLQLKPNITNSAR
HVLEGLLQKDRTKRLGAKDDFMEIKNHVFFSLINWDDLINKKITPPFNPNVSGPSDLRHF
DPEFTEEPVPNSIGRSPDSILLTASVKEAAEAFLGFSYAPPVDSFL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggtaaacaaagacatgaatggattcccagtcaagaaatgctcagccttccaatttttt
aagaagcgggtacgaagatggatcaagagtccgatggtcagcgtggacaagcatcagagt
cccagcctgaagtacacgggcccctcagtggtgtacgtgccaccaggggagccagacttt
gagccttcgttgtgtcagacgtgcctgggagaccaagctttccaaagaggggttctccct
caggagaacgagtcaagctcatgggaaactcaatccgggtgcgaagtgaaagaaccatgt
aatcatgccaacatcctgtccaagcctgacccaagaaccttctggactaatgatgactca
gctttcatgaaacagagaaggatgggcctgaacgactttattcagaagattgccaataac
tcctatgcatgcaaacaccctgaagttcagtccattttgaaaatctcccaacctcaggag
cctgagctcatgaatgccaacccttctcctccaccaagtccttctcagcaaattaacctg
ggcccatcatccaatcctcatgctaaaccatctgactttcacttcttgaaagtgatcggg
aagggcagttttggaaaggttctcctggcaagacacaaagccgaagaagcattctatgca
gtcaaagttttacaaaagaaagcgatcctgaaaaagaaggaggaaaagcatattatgtcg
gagcggaatgtcctcctgaagaacgtgaaacaccctttcctggtgggccttcacttctct
ttccagacggctgataaactgtactttgtcctagactacattaacggtggagagttgttc
taccatctccagagggagcgatgcttcctggaaccacgggctcggttctatgctgctgaa
atagccagtgccttgggttacctgcactccctgaacatcgtttatagagacttaaagcca
gagaatatcttgctggattcacagggacacattgtccttactgactttggactctgcaag
gagaacattgaacacaatggcacgacgtctaccttctgcggcacacccgagtatcttgca
cctgaggtgcttcataagcagccttatgataggaccgtggactggtggtgtctgggggcc
gtcttatatgagatgctgtatggcctgcctcccttttatagccgaaacacagctgagatg
tacgacaacattctgaacaaacccctccagctgaagccaaatattacaaattctgcaaga
cacgtcctggagggcctcctgcagaaggacaggacaaagaggcttggtgccaaggatgac
tttatggagattaagaatcacgtcttcttctccctaattaactgggatgatctcattaat
aagaagattactcccccttttaacccaaatgtgagtgggcccagcgacctgcggcacttt
gatcccgagtttaccgaagagccggtccccaactccatcggtcggtcgcccgacagcatc
ctcctcacagccagcgtcaaggaagcggccgaggccttcctgggcttttcctacgcacct
cccgtggactccttcctctga

DBGET integrated database retrieval system