KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003756
Entry
103003756         CDS       T03086                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04216  Ferroptosis
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    103003756 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003756 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103003756 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 103003756
NCBI-ProteinID: XP_007176345
UniProt: A0A383ZMM3
LinkDB
Position
Un
AA seq 625 aa
MSTSQDQSGCSSNKEPHLRCCDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFNCLIHQLECTQNKDLANQVSV
CLERLGSLTLKPEDSTVLLFEADITALRQAITTFGSLKTIQIPEHLMAHASSSNIGPFLE
KRGYIALPEQQKSATSTTSVPLSEWLLGSKPASGRQAPYIPSTNLQDWLTQKQTLENSQT
SARACNFFSNVWGNLKGLENWLHKSQKQEVSEKPSYQKCNSYSTTSSYSIEIEKVGDLEL
LDQDEMELSDWLVTPQESHKLEKAGNGSCETSEKFKLLFQVFQESYSVNDWLIKPDSCTN
CQGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSVITEDWLVQNHQDPYKVEEVCKANEP
CTSFAECVCDENCEKEALCKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPSRREAT
EQAKAPKAMASSRIADSFQVIRNSPLSEWLITPSCKEGCPKEVPLREDRAGIPKLTSHLA
TSWCPFNTADWVLPGKKTGNLSQLSSGEDKWLLRKAKEVLLNSPLQEERSFPPDRYGLPA
VCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgagtacctcacaggaccagagtggctgctctagtaataaagaaccccatttgaggtgt
tgtgatgcacggagggacttggagcttgctattggtggagttctccgggctgaacagcaa
attaaagataacttgcgagaggtgaaagcccagattcacagctgcataagtcgtcacctg
gaatgccttcgaagccgtgaggtgtggctgtatgaacaggtagatctcatctatcagctt
aaagaggagacgcttcagcagcaggcccaacagctctactggttgctgggccagttcaat
tgtcttattcatcagctggagtgcacccagaacaaagatctagccaatcaagtctccgtg
tgcctggagagactgggcagtttgaccctcaaacctgaagattcaactgtcctactcttt
gaagccgatataactgccctgcgccaggcaatcaccacgtttgggtctcttaagaccatt
caaattcctgagcacctgatggctcatgctagttcatcaaacattgggcccttcctggag
aaaagaggctatatcgcattgccagagcagcagaagtcagcaaccagcaccacatctgtc
cctctcagcgaatggctccttggaagcaaacctgccagcggtcgccaggctccttacata
cccagtaccaatctgcaggactggctcacccaaaagcagaccttggagaatagtcagact
tctgccagagcctgcaatttcttcagtaatgtctggggcaacctaaagggcttggaaaat
tggctccacaagagtcagaaacaagaagtttctgaaaaaccaagttaccaaaagtgtaac
agctattctactaccagttcttactccattgaaattgaaaaggttggagatctagagctt
cttgatcaagatgagatggagctttctgattggctggtgactccccaggaatcccataag
cttgagaaggctgggaatggcagctgtgaaaccagtgagaagtttaagctcttgttccag
gtgttccaggagtcctatagtgtgaatgattggctcatcaagcctgattcctgtaccaat
tgtcagggtaaccagcccaaaggtgtggagattgagaacctgggcaatctgaagtgcctg
aatgaccacttggaggccaagaaacccttgtccactcccagcgtgattactgaggattgg
cttgtccagaatcatcaagacccatataaagtagaggaggtctgcaaagccaatgagccc
tgtacaagctttgcagagtgcgtgtgtgatgaaaattgtgagaaggaagctctgtgtaaa
tggcttctgaagaaagaaggaaaggataaaaatggtatgcctgtggaaccaaaacctgaa
cctgagaaacataaagattccctgaatatgtggctctgtccatccagaagagaggcaaca
gaacaagccaaggcaccgaaggcaatggcttcttctagaattgctgattccttccaagtc
ataaggaacagtcccttgtcagagtggctcattaccccctcatgcaaagaaggatgtccc
aaggaagtgcctcttagagaggacagagctggcataccaaagcttacaagccacttggcc
acttcctggtgtccctttaacacggctgactgggtcttgccaggaaagaagacaggaaat
cttagccagttatcctcaggagaagacaaatggctacttcgaaaggccaaggaagtatta
cttaattcgcccctacaggaggaacgcagctttcccccagaccgttacggcctcccagca
gtttgtgatctctttgcctgtatgcagcttaaagttgataaagaaaaatggttgtatcga
actcctctacagatgtga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006627
Entry
103006627         CDS       T03086                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
bacu05223  Non-small cell lung cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103006627 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006627 (RET)
   05230 Central carbon metabolism in cancer
    103006627 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103006627 (RET)
   05223 Non-small cell lung cancer
    103006627 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103006627 (RET)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103006627 (RET)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  RET family
   103006627 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD4 RET_CLD3 Pkinase RET_CLD1 Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 103006627
NCBI-ProteinID: XP_007170872
UniProt: A0A383Z756
LinkDB
Position
Un
AA seq 1026 aa
MPLLYVHALQDVPEEVPSFRLGQHLYGAYRTRLHENDWVRIQEDTGLLYLNRSLDHSSWE
KLSIRNGGFPLLTVYLQVFLSPVSLRQGECQWPGCARVYFSLINASFPACGALKPRELCF
PETGLSFRIRENRPPGTFHQFRLLPVQFLCPNVSVAYRLLGGEGLPFRCAVDSLEVSTRW
ALDREQREKYELVAVCAVRVGAREEEVMVPFPVTVYDEDDSAPSFLGGVDTASAVVEFKR
KEGTVAATLRVFDADVVPAPGELLRRYTSTLLSGDAWALQTFRVEHSPNETLAQANGSFV
RATVHDYRLVLNRSLPISESRAVQLAVLVNDSDFQGPGEGILLLHFNVSVLPVSLRLPST
YSFAASRRARRFAQIGKVCVENCQEFSGIHVQYKLQLSSANCSALGMVTSAEDTMGTLFV
NDTEALQRPECAQLQYTVVAVERPTRRQAQAPLLVTLEGTYVAEEAGCPVSCAVNKRRPE
CEECGGLGSLTGRCEWRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESRDANICPQDCLR
GGSIIGGHEPGERRGIKAGFGICNCFPEEKKCFCEPEDSPDPLCDELCRTVIAAAVLFSF
IVSVLLSTFCIHRYHKNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSVENQVSV
DAFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASA
SELRDLLSEFNLLTQVSHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGY
VGSRDSRNSSYLDNPEERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGR
RMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVT
LGGNPYPGIPPERLFNLLKTGYRMERPDNCSEEMYSLMLQCWKEEPDKRPVFADISKDLD
KMMVKSRDYLDLAASTPSDSLLYDDGLSEEEMPLVDCNNAPLPRTLPSTWIENKLYGRIS
HAFTRF
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgcccctgctctacgtccacgccctgcaggacgtccccgaggaggtgcccagcttccgc
ctgggccagcacctctacggcgcctaccgcacgcggctgcacgagaacgactgggtccgt
atccaggaggacacggggcttctctaccttaaccggagcctggaccacagctcctgggag
aagctcagcattcgcaacggtggcttcccgctgctcaccgtctacctccaggtcttcctg
tcgcccgtgtcccttcgtcagggcgagtgccagtggccgggctgtgcccgagtgtacttc
tccctcatcaacgcctccttcccggcttgtggtgccctcaaaccccgggagctctgcttc
cccgagacgggcctctccttccgcattcgggagaacaggcctcccggcaccttccaccag
ttccgtctgctgcctgtgcaattcctctgccccaacgtcagcgtggcctaccggcttctg
ggaggtgagggtctgcccttccgctgcgctgtggacagcctggaggtgagcacgcgctgg
gccctggaccgcgagcagcgggagaagtatgagctggtggctgtgtgcgcggtgcgcgtc
ggcgcgcgggaggaggaggtgatggtgcccttccccgtgaccgtgtacgacgaagacgac
tctgcgcccagcttcctcgggggcgtcgacaccgccagcgccgtcgtggagttcaagcgg
aaggagggcactgttgcggccacactacgtgtcttcgatgcagatgtggtgccagcaccc
ggggagctcctgaggcggtacacaagcacgctgctctccggggacgcctgggccctccag
accttccgagtagagcactcgcccaacgagaccttggcccaggccaacggcagctttgtg
cgggcaaccgtgcatgactacaggctggttctcaaccggagcctccccatctcggagagc
cgggccgtgcagctggccgtgctggtcaacgactcggacttccagggccccggggagggc
atcctcctcctccacttcaacgtgtccgtgctgcccgtcagcctgcgcctgcccagcacc
tactcctttgccgcgagcaggcgggcccgccgcttcgcccagattgggaaagtctgtgtg
gaaaactgccaggagttcagtggcatccacgtgcagtacaagctgcagctctccagcgcc
aactgcagcgccctggggatggtcacctcggccgaggacaccatggggaccctgttcgtg
aacgacacggaggccctgcagcggcccgagtgtgcccaactccagtacacggtagtggcc
gtcgaacggccaacccgccggcaagcccaggccccactgctcgtcacactggaggggaca
tacgtggcagaggaggcaggctgccccgtgtcctgcgcggtcaacaagaggcggcccgag
tgtgaggaatgcggcggcctgggctctctgacgggcaggtgcgagtggagacagggagac
ggcaaagggatcaccaggaacttctccacctgctcccccagcatcaagacctgccccgat
ggccactgtgacgccgtggaaagcagagacgccaacatctgcccccaggactgcctccgg
ggcggcagcatcattggtgggcacgagcctggggaacgccgggggattaaagccggcttc
ggtatctgcaactgcttcccggaggagaagaagtgcttctgcgagccggaagacagcccg
gacccgctgtgtgacgagctttgccgcacggtgatcgcggcagccgtgctcttctccttc
atcgtgtccgtgctgctgtccaccttctgcatccaccgctaccacaagaacgcccacaag
ccgcccatcgcctcagctgagatgaccttccgccggcccgcccaggcctttcccgtcagc
tactcctcatccggtgcccgccggccctcgctggactccgtggagaaccaggtctctgtg
gacgccttcaagatcccggaggatccaaagtgggaattccctcggaagaacttggttctt
ggaaaaactctgggagaaggagaatttggaaaagtggtcaaggcaacggccttccggctg
aaaggcaaagcggggtacacgactgtggctgtaaagatgctgaaagagaacgcctcggcg
agcgagctgcgggacctgctgtcagagttcaacctcctgacgcaggtcagccacccgcaa
gtcatcaagctgtacggggcctgcagccaggacgggccgctgctcctcatcgtggagtat
gccaagtacggctccctgcggggcttcctccgagagagccgcaaggcggggcccggctat
gtgggcagcagagacagccgcaactccagctacctggacaacccggaggagcgggccctg
accatgggcgacctcatctccttcgcctggcagatctcgcgggggatgcagtacctggcc
gagatgaagctcgtccatcgggacttggcagccagaaacgtcctagtagccgaggggcgc
aggatgaagatctcagattttggtctgtcccgtgatgtttatgaagaggattcctacgtg
aagagaagcaagggtcggatcccagtcaagtggatggccattgagtccctcttcgatcac
atctacaccacccagagtgacgtgtggtccttcggtgtcctgctgtgggagattgtgacc
ctggggggcaacccctaccctgggattcctccagagcggctcttcaaccttctgaagaca
ggctaccggatggagaggccagacaactgcagcgaggagatgtacagtctgatgctgcag
tgctggaaggaggagccagacaagagaccagtgtttgccgacatcagcaaagacctggat
aagatgatggttaagagcagagactacttggacctggccgcgtccaccccatccgactcc
ctgctgtacgacgacggcctgtcggaggaggagatgcccctggtggactgtaataacgct
cccctccctcgcaccctcccctccacgtggattgaaaacaaactctatggtagaatttca
catgcatttactagattctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012560
Entry
103012560         CDS       T03086                                 

Gene name
CCDC6
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012560 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103012560 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 103012560
NCBI-ProteinID: XP_007170893
UniProt: A0A383Z6U4
LinkDB
Position
Un
AA seq 454 aa
MQSSCSSTSGAGSGGGGGGGGGGGKSGGIVISPFRLEELTNRLASLQQENKVLKIELETY
KLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEF
LTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKI
DLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEIDSPENMMR
HIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREMERREALCR
QLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYASHTVGFT
PPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQP
PPPPPPPPMQPAVPSAATSQPAPLQHPVHPSSQP
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgcagtcatcttgctcgtcgacctcgggcgccggcagcggcggtggcggcgggggaggc
ggcggcggtgggaagtcggggggcattgtcatctcgccgttccgcctggaggagctcacc
aaccgcctggcctcgctgcagcaggagaacaaggtgctcaagatcgagctggagacctac
aaactcaagtgcaaggcgctgcaggaggagaaccgcgacctgcgcaaagccagcgtgacc
atccaagcccgggctgagcaggaagaagaattcatcagtaacactttattcaagaaaatt
caggctttgcagaaggagaaagaaacccttgctgtaaattatgagaaggaagaagagttc
ctcactaatgagctctccagaaaattgatgcagttgcagcatgagaaagctgaactagaa
cagcatctcgagcaggagcaggaattccaggtcaacaaactgatgaagaaaattaaaaaa
ctggagaacgataccatttctaagcagcttacgttagaacagctgagacgagagaagatt
gaccttgaaaatactttggaacaagaacaagaggcactagtgaatcgtctctggaaaagg
atggataaacttgaagctgaaaagcgaatcctgcaggagaaattagaccagccggtgtct
gctcccccatcgcctagagacatctccatggagatcgactctccagaaaacatgatgcga
cacatcaggtttttaaagaatgaagtggagaggctgaagaagcaactgagagctgcccag
ttacagcattccgagaaaatggcgcagtatctggaggaggaacgtcacatgagggaagag
aacctgaggctgcagaggaagctgcagagggagatggagagaagagaggccctctgtcgc
cagctctccgagagcgagtccagcttagagatggatgatgaaaggtattttaacgagatg
tctgcacaaggattaagacctcgcactgtgtccagcccgatcccttacacaccttctccc
agttctagccggccgatatcacctggtctctcgtatgcaagtcacacagttggtttcacg
ccaccaacttcactgactagagccggaatgtcttattacaattccccaggtcttcatgtg
cagcatatgggagcatcccacggtatcacaaggccttcaccgcggaggagcaacagcccc
gacaaattcaaacggcccacgccgcctccgtctcccaacacacagacccccgtccagcct
ccgccacctccacctccgccacccatgcagcccgcggtcccctcggcagccacctcgcag
cccgcccccttgcaacatccagtgcacccctcctcccagccttaa

DBGET integrated database retrieval system