KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003760
Entry
103003760         CDS       T03086                                 

Gene name
RPS6
Definition
(RefSeq) ribosomal protein S6
  KO
K02991  small subunit ribosomal protein S6e
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu03010  Ribosome
bacu04066  HIF-1 signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04371  Apelin signaling pathway
bacu04714  Thermogenesis
bacu04910  Insulin signaling pathway
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    103003760 (RPS6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103003760 (RPS6)
   04066 HIF-1 signaling pathway
    103003760 (RPS6)
   04151 PI3K-Akt signaling pathway
    103003760 (RPS6)
   04150 mTOR signaling pathway
    103003760 (RPS6)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103003760 (RPS6)
  09159 Environmental adaptation
   04714 Thermogenesis
    103003760 (RPS6)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103003760 (RPS6)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103003760 (RPS6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103003760 (RPS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bacu03011]
    103003760 (RPS6)
Ribosome [BR:bacu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    103003760 (RPS6)
  Archaea
    103003760 (RPS6)
SSDB
Motif
Pfam: Ribosomal_S6e
Other DBs
NCBI-GeneID: 103003760
NCBI-ProteinID: XP_007176859
UniProt: A0A383ZPL4
LinkDB
Position
Un
AA seq 247 aa
MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQG
FPMKQGVLTHGRVRLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIP
GLTDTTVPRRLGPKRASRIRKLFNLSKEDDVRQYVVRKPLNKEGKKPRTKAPKIQRLVTP
RVLQHKRRRIALKKQRTKKNKEEAAEYAKLLAKRMKEAKEKRQEQIAKRRRLSSLRASTS
KSESSQK
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaagctgaacatctctttcccggccactggctgccagaaactcattgaagtggacgat
gaacgaaaacttcgtaccttttatgagaagcgtatggccacagaagttgctgctgacgct
ctgggtgaagaatggaagggttatgtggtccgaatcagtggtgggaacgacaaacagggt
ttccccatgaagcagggtgtcttgacccatggccgagtccgcctgagtaaggggcattct
tgttacagaccaaggaggactggagaaagaaagcgcaaatctgtacggggttgcattgtg
gatgccaatctgagcgttctcaatttggtcattgtaaaaaaaggagagaaggatattcct
ggactcactgatactactgtgcctcgtcgcctggggcccaaaagagctagcagaatccgc
aaacttttcaatctctctaaagaagatgatgtccgccagtatgttgtgagaaagccccta
aacaaagaaggtaagaaacctaggaccaaagcacccaagattcagcgtcttgttactcca
cgtgttctgcaacacaaacgtcggcgaattgctctgaagaaacagcgtactaagaaaaat
aaggaagaggctgcagaatatgctaaacttttggccaagagaatgaaggaggccaaagaa
aaacgccaggaacagattgccaagagacggaggctgtcctctctgagagcttctacttct
aagtctgagtccagtcaaaaatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103010179
Entry
103010179         CDS       T03086                                 

Definition
(RefSeq) 40S ribosomal protein S6-like
  KO
K02991  small subunit ribosomal protein S6e
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu03010  Ribosome
bacu04066  HIF-1 signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04371  Apelin signaling pathway
bacu04714  Thermogenesis
bacu04910  Insulin signaling pathway
bacu05171  Coronavirus disease - COVID-19
bacu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    103010179
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103010179
   04066 HIF-1 signaling pathway
    103010179
   04151 PI3K-Akt signaling pathway
    103010179
   04150 mTOR signaling pathway
    103010179
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103010179
  09159 Environmental adaptation
   04714 Thermogenesis
    103010179
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103010179
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    103010179
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103010179
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bacu03011]
    103010179
Ribosome [BR:bacu03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    103010179
  Archaea
    103010179
SSDB
Motif
Pfam: Ribosomal_S6e
Other DBs
NCBI-GeneID: 103010179
NCBI-ProteinID: XP_007197157
LinkDB
Position
Un
AA seq 230 aa
MIEIHQALFRGASEAVGRFRMKLNISFPATGCQKLIEVDDERKLLTFYEKHMATEVAADA
LDSCYRPRRTGERKRKSVRGCIVDANLRVLNMVIVKKGEKDIPGLTDTTVPCRLGPKRSS
RIRKLFNLSKEDDVCQYVVRKPLNKEGKKPRTKAPKIQRLVTPRVLQHKRQRIALKKQRT
KKNKEEAAEYAKLLAKRMKEAKEKCQEQIAKRRRLSSLRASTSKSESSQK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatagaaattcaccaagctctttttcgtggcgcctcggaggcggtcggccgcttcaga
atgaagctgaacatctctttcccggccactggctgccagaaactcattgaagtggacgat
gaacgaaaacttcttaccttttatgagaagcatatggccacagaagttgctgctgacgct
ctggattcctgttacagaccaaggaggactggagaaagaaagcgcaaatctgtacggggt
tgcattgtggatgccaatctgagagttctcaatatggtcattgtaaaaaaaggggagaag
gatattcctggactcactgatactactgtgccttgtcgcctggggcccaaaagatctagc
agaatccgcaaacttttcaatctctctaaagaagatgatgtctgccagtacgttgtgaga
aagcccctaaacaaagaaggtaagaaacctaggaccaaagcacccaagattcagcgtctt
gttactccacgtgttctgcaacacaaacgtcagcgaattgctctgaagaaacagcgtact
aagaaaaataaggaagaggctgcagaatatgctaaacttttggccaagagaatgaaggag
gccaaagaaaaatgccaggaacagattgccaagagacggaggctgtcctccctgagagct
tctacttctaagtctgagtccagtcaaaaatga

DBGET integrated database retrieval system