KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103003780
Entry
103003780         CDS       T03086                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00220  Arginine biosynthesis
bacu00330  Arginine and proline metabolism
bacu01100  Metabolic pathways
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04146  Peroxisome
bacu04371  Apelin signaling pathway
bacu04926  Relaxin signaling pathway
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05133  Pertussis
bacu05140  Leishmaniasis
bacu05142  Chagas disease
bacu05145  Toxoplasmosis
bacu05146  Amoebiasis
bacu05152  Tuberculosis
bacu05200  Pathways in cancer
bacu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    103003780 (NOS2)
   00330 Arginine and proline metabolism
    103003780 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103003780 (NOS2)
   04066 HIF-1 signaling pathway
    103003780 (NOS2)
   04020 Calcium signaling pathway
    103003780 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103003780 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103003780 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103003780 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    103003780 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103003780 (NOS2)
   05014 Amyotrophic lateral sclerosis
    103003780 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    103003780 (NOS2)
   05152 Tuberculosis
    103003780 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103003780 (NOS2)
   05145 Toxoplasmosis
    103003780 (NOS2)
   05140 Leishmaniasis
    103003780 (NOS2)
   05142 Chagas disease
    103003780 (NOS2)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     103003780 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 103003780
NCBI-ProteinID: XP_007183973
UniProt: A0A384A9H7
LinkDB
Position
Un
AA seq 1157 aa
MACPWQFLFKAKSYKFDLTEEIDINNNVEKAHQPLSSPVTQDDPKCHSLGKHRNESSQPL
TGTAKQSPESLVKPAAPPSACPRHVRIKNWGSGMTFQDTLHHKAKRDLACKSRSCLGAIM
NPKSLTIGPRDKPTLPEELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYATNSGNI
RLAITVFPQRSDGKHDFRVWNAQLIQYAGYQMPDGAIRGDPASVEFTQLCIDLGWKPKYG
RFDVVPLVLQADGQDPELFEIPPDLVFEVPMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKVASLWKDRAVIEINV
AVLHSFQKHNVTITDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPISGSITPVFHQEM
LNYILSPFYYYQVAAWKTHVWQDERRRPRRREIRFKVLVKAVLFASVLMRERMASRVRAT
ILFATETGRSETLAQDLGALFSCAFNPKVLCMDEYKLSHLEEEELLLVVTSTFGNGDSPG
NGEKLKKSLFMLKELTNKFRYAVFGLGSSMYPQFCAFAHDIDQKLSQLGASQLAPTGEGD
ELSGQEEAFRAWAVQTFKAACETFDVRGKHHIQIPKLYTATVTWDLHHYRLVQDSQPLDL
NKALSSMHAKHVFTMRLKSRQNLQSPKSSRTTLLVELSYEGSQGPSYLPGEHLGVFPGNQ
PALVQGILERVVDGPAPDQPMRLETLCENGSYWVRDKRLPICSLSQALTYFLDITTPPTQ
LLLQKLAQLATDEAERQRLETLCQPSNYNTWKFTNSPTFLEVLEEFPSLRVPASFLLSQL
PVLKPRYYSISSSRDHTPTEIHLTVAVLTYRTRDGQGPLHHGVCSTWLSNLKPQDLVPCF
VRSASGFQLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDAEHNGLQSGRMTLVFGCRHPD
EDHIYREEMLEMTRKGVLHEVHTAYSRLPDQPKVYVQDILRQQLADEVLRVLHEERGHLY
VCGDVRMARDVARTLKQLVATALSLTEEQVEDYFFQLKSQKRYHEDIFGAVFPYEVKKDG
AAELPSNTRAPSAHRRS
NT seq 3474 nt   +upstreamnt  +downstreamnt
atggcctgtccctggcagtttctattcaaggccaaatcctataagtttgacttgactgag
gaaatagacatcaacaacaatgtggagaaagcccaccagcctctctccagtccagtgaca
caggatgaccccaaatgtcacagcctcggcaagcaccggaatgaatcttcccagcccctc
acggggacagcaaagcagtctccagaatccctggtcaagccggctgcacccccatcggcc
tgcccacggcatgtgaggatcaaaaactggggcagtgggatgactttccaagacacactt
caccacaaggccaaaagggatctcgcttgcaagtccaggtcttgcctgggagccatcatg
aaccccaaaagtttgaccataggacccagggacaagcctaccctcccagaagagcttcta
cctcaagctattgaatttgtcaaccagtattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccag
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaacgccccccgctgc
atcgggaggatccagtggtccaacctgcaggtcttcgacgcgcggagctgttccacggcc
caggagatgttcgagcacatctgcagacacctgcgttatgccaccaacagcggcaacatc
aggttggccatcaccgtgttcccccaacggagcgacgggaaacatgacttccgggtctgg
aacgcccagctcatccagtacgccggctaccagatgcccgatggcgccatcagaggggac
cccgccagcgtggagttcacgcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtgcctctggtcctgcaggctgatggccaggaccctgagctcttcgaa
atccctcccgaccttgtgtttgaggtgcccatggaacatcccaagtatgagtggttccgg
gagctggagctgaagtggtatgccctgccggccgtagccaacatgctgctcgaggtgggt
ggccttgagttccccgggtgccccttcaacggttggtatatgggcacggagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggaggatgggc
ctggaaacacacaaggtggcctcactctggaaagaccgggctgtcattgagatcaacgtc
gctgtgctccacagtttccagaagcataatgtgaccatcacggaccaccactcagctgca
gagtccttcatgaagtacatgcagaatgagtaccggtcccgagggggctgcccagctgac
tggatttggctggtccccccaatttctggaagcatcacccccgtgttccaccaggagatg
ttaaattatatcctgtcccctttctactactaccaggtggcggcctggaaaacccacgtc
tggcaggatgagaggcggagaccccggagaagagagattcgattcaaagtcttggtcaaa
gccgtgctctttgcctcagtgctgatgcgtgagagaatggcatcccgggtcagagccacg
atcctctttgcaacagagacgggaagatcagaaacgctggcccaggacctaggggccttg
ttcagctgcgccttcaaccctaaggttctctgcatggacgaatacaagctgagccatctg
gaggaggaagagctgctgctggtggtgaccagcacgttcgggaacggagactcccccggc
aacggagagaaactgaagaagtccctcttcatgctgaaagaactcaccaacaaattcagg
tatgccgtgtttggcctcggctccagcatgtaccctcagttctgcgcctttgctcatgac
atcgaccagaagttgtcccagctgggggcttctcagcttgccccaacaggggaaggggac
gagctcagcgggcaggaggaggccttccgtgcctgggccgtgcaaaccttcaaggcagcc
tgtgagacgttcgatgtccgaggcaaacaccacattcagatccccaagctctacactgcc
actgtgacctgggacctgcaccactacaggctcgtgcaagactcacagcctttggacctc
aacaaagccctcagcagtatgcacgccaagcatgtgttcaccatgaggctgaaatcgcgg
cagaatctacagagtccaaaatccagccgtaccaccctcctggtggaactgtcctatgag
ggcagccaaggtccaagctacctgccgggagagcacctcggagttttcccaggcaaccag
ccagctctggtccaaggcatcctggagcgagtggtggatggccctgcccccgaccaaccc
atgcgcctggagaccctctgcgagaatggcagctactgggtccgggacaagcggctgccc
atctgctcactcagccaggctctcacctatttcctggacatcaccaccccaccaacccag
ctgctgctccaaaagctggcccagctggccacggacgaggctgagaggcagaggctggag
accctgtgccagccatctaattacaacacgtggaagttcaccaatagccccaccttcctg
gaggtgctggaggagttcccgtccctgcgggtgcctgccagcttcctgctctcccagctg
cctgtcctgaagccccggtactactccatcagctcctccagggaccacacacccacggag
atccacctcactgtggccgtgctcacgtaccgcacccgagacggccagggtcccctgcac
cacggcgtctgcagcacatggctcagcaacctgaagccccaagacctggtgccctgcttt
gtgcgaagtgccagcggcttccagctccccgaggacccctcccacccttgcatcctcatc
gggcctggcacgggcatcgcccccttccgcagtttctggcagcagcggctgcatgatgcc
gagcacaatggtctccagagtggccgcatgaccctggtgtttgggtgccgccacccagat
gaggaccacatctaccgggaggagatgttggagatgacccggaagggggtgctgcatgag
gtgcacacagcctattctcgcctgcctgaccagcccaaggtctacgttcaagacatcctg
cggcagcagctggcggacgaggtgctccgcgtgctccacgaggagcgaggccacctctat
gtctgcggggacgtgcgcatggcccgggatgtggcccgcaccctgaagcagctggtggcc
accgcgctgagcctaactgaggagcaggtggaggactacttcttccagcttaagagccag
aagcgctatcatgaagatatctttggtgctgtatttccctatgaggtgaaaaaggatggg
gcagcggagctgcccagcaataccagagctccaagcgcccacaggagaagttaa

DBGET integrated database retrieval system