KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004045
Entry
103004045         CDS       T03086                                 

Gene name
KIF5C
Definition
(RefSeq) kinesin family member 5C
  KO
K10396  kinesin family member 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04144  Endocytosis
bacu04728  Dopaminergic synapse
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103004045 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    103004045 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103004045 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004045 (KIF5C)
   05012 Parkinson disease
    103004045 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    103004045 (KIF5C)
   05016 Huntington disease
    103004045 (KIF5C)
   05020 Prion disease
    103004045 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    103004045 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103004045 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103004045 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103004045 (KIF5C)
   04147 Exosome [BR:bacu04147]
    103004045 (KIF5C)
Membrane trafficking [BR:bacu04131]
 Others
  Actin-binding proteins
   Others
    103004045 (KIF5C)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     103004045 (KIF5C)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103004045 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd Cnn_1N
Other DBs
NCBI-GeneID: 103004045
NCBI-ProteinID: XP_007183098
UniProt: A0A384A6X5
LinkDB
Position
Un
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPTTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVL
QHLEMELNRWRNGEAVPEDEQISAKDQKPLEPCDNTPIIDNIVPVVADISAEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEKLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKFFVQDLTARVKKSVELDSDEGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKSLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGSSSNSTHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggccactcaacgaa
gctgagatcctccgcggggacaaattcatccccaaatttaaaggcgatgagaccgtggtg
atcgggcaaggaaagccatatgtcttcgacagagtgctgcctcccaccacgacccaagag
caggtttacaacgcgtgtgcaaagcaaattgtcaaagatgtccttgagggttataatggg
acaatttttgcgtatggacagacatcatcaggaaaaacgcacaccatggaggggaagcta
cacgaccctcaactcatgggcatcatcccaaggatcgcacacgacatctttgaccatatc
tattccatggatgaaaacctggagttccacatcaaggtttcctattttgaaatctacttg
gacaaaatcagggacttactcgatgtatccaagacaaacttggctgttcatgaagataaa
aacagagtcccgtatgtaaaggggtgcaccgagcggtttgtgtcaagccccgaggaggtc
atggacgtgatagatgaaggcaaagcaaaccgccacgtggctgtaacgaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtagagact
gaaaaaaaactcagtgggaagctttatctagttgatttggctgggagcgaaaaggtcagc
aaaactggtgccgagggagctgttctcgatgaagctaaaaatatcaataagtctttgtct
gctcttggaaatgtgatctctgccttggcagaagggacaaaaacacacgtgccgtaccgg
gacagcaagatgactcggattcttcaggactctctgggtgggaactgtagaaccaccatc
gttatttgctgttctccctcggtattcaatgaagctgagaccaagtcaacgctaatgttt
ggacaaagggctaagaccatcaagaatacagtctctgtgaacctggagctgacagcggaa
gaatggaagaagaaatatgaaaaagagaaagagaaaaacaagactttgaagaatgttctc
cagcatctggagatggagctaaacaggtggagaaatggagaagctgtgcctgaggatgaa
cagatcagtgctaaggaccagaagcccctggagccctgtgataacacccccatcatagac
aacattgttcctgtggttgccgacatctctgcagaggagaaggagaagtatgatgaggag
atctccagtctctaccgacaactggatgataaggatgatgaaattaaccagcagagccag
ctggctgaaaagctaaagcaacagatgttggatcaggatgagcttttagcttccacaaga
agagactatgagaagattcaggaggagctgacacgtctccagattgaaaatgaggcagcc
aaagacgaggtgaaagaagttctccaggccctggaggagctggctgtcaattacgaccag
aagtcacaggaagtggaggacaagaccagggccaatgagcagctgacagatgagctggcc
cagaaaacgactacattgacaaccacacaaagagagctgagccagctgcaagagcttagc
aatcaccagaaaaagagggccaccgagatcctgaatttgctgctgaaggatctgggggag
ataggaggaattattggcaccaatgatgtgaagactttggcagatgtgaatggagtcatt
gaggaggaattcaccatggcccggctgtacatcagcaagatgaagtcggaggttaaatcc
ctggtgaaccgcagtaaacagctcgagagcgcccagatggactccaacaggaaaatgaat
gccagtgagcgggagctggcagcctgccagctgctcatctcccagcatgaagccaagatc
aaatccctgaccgactacatgcagaacatggagcagaagaggaggcagctggaagagtcg
caagactcgctcagcgaggagctggccaagctccgagcccaagaaaaaatgcatgaagtc
agcttccaggataaagaaaaggaacatctgacccggctgcaggatgctgaggaaatgaag
aaggcgctggagcaacagatggagagccaccgggaagctcatcagaagcagctgtccaga
ctccgagatgaaatcgaggagaagcagaaaatcatcgatgagattcgggatttgaatcag
aaactgcaactggaacaggagaagctcagttctgattataacaagctgaaaatagaggac
caagagagagaaatgaaactggaaaagctcttattgctcaatgataaaagagaacaagcc
agagaggacctcaaagggctggaggagacagtgtctcgggaactacagactctgcacaac
ctccgtaaattcttcgtccaggatctgaccgcccgggttaaaaaaagtgtagagctggac
agcgacgagggaggaggcagcgctgcccagaagcagaaaatttccttcctggagaataac
ctggagcagctcactaaggtccacaaacagctggtccgggacaacgcagacctgcgctgt
gagctgcccaagctggagaagagcctgcgtgccacggccgagcgcgtcaaggcgctggag
agcgcgctgaaggaggccaaggagaacgccatgcgggaccgcaagcgctaccagcaggag
gtggaccgcatcaaggaggctgtgcgagccaagaacatggccaggagggcccactcggcc
cagatcgccaagcccatccgccctggacactacccagcatcgtctccaacggccgtccac
gccatccgagggggaggaggcagctcttcaaactccactcactaccagaaataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103006627
Entry
103006627         CDS       T03086                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04020  Calcium signaling pathway
bacu05200  Pathways in cancer
bacu05216  Thyroid cancer
bacu05223  Non-small cell lung cancer
bacu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103006627 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103006627 (RET)
   05230 Central carbon metabolism in cancer
    103006627 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    103006627 (RET)
   05223 Non-small cell lung cancer
    103006627 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103006627 (RET)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103006627 (RET)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  RET family
   103006627 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD4 RET_CLD3 Pkinase RET_CLD1 Cadherin Pkinase_fungal RIO1
Other DBs
NCBI-GeneID: 103006627
NCBI-ProteinID: XP_007170872
UniProt: A0A383Z756
LinkDB
Position
Un
AA seq 1026 aa
MPLLYVHALQDVPEEVPSFRLGQHLYGAYRTRLHENDWVRIQEDTGLLYLNRSLDHSSWE
KLSIRNGGFPLLTVYLQVFLSPVSLRQGECQWPGCARVYFSLINASFPACGALKPRELCF
PETGLSFRIRENRPPGTFHQFRLLPVQFLCPNVSVAYRLLGGEGLPFRCAVDSLEVSTRW
ALDREQREKYELVAVCAVRVGAREEEVMVPFPVTVYDEDDSAPSFLGGVDTASAVVEFKR
KEGTVAATLRVFDADVVPAPGELLRRYTSTLLSGDAWALQTFRVEHSPNETLAQANGSFV
RATVHDYRLVLNRSLPISESRAVQLAVLVNDSDFQGPGEGILLLHFNVSVLPVSLRLPST
YSFAASRRARRFAQIGKVCVENCQEFSGIHVQYKLQLSSANCSALGMVTSAEDTMGTLFV
NDTEALQRPECAQLQYTVVAVERPTRRQAQAPLLVTLEGTYVAEEAGCPVSCAVNKRRPE
CEECGGLGSLTGRCEWRQGDGKGITRNFSTCSPSIKTCPDGHCDAVESRDANICPQDCLR
GGSIIGGHEPGERRGIKAGFGICNCFPEEKKCFCEPEDSPDPLCDELCRTVIAAAVLFSF
IVSVLLSTFCIHRYHKNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSVENQVSV
DAFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASA
SELRDLLSEFNLLTQVSHPQVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKAGPGY
VGSRDSRNSSYLDNPEERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGR
RMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVT
LGGNPYPGIPPERLFNLLKTGYRMERPDNCSEEMYSLMLQCWKEEPDKRPVFADISKDLD
KMMVKSRDYLDLAASTPSDSLLYDDGLSEEEMPLVDCNNAPLPRTLPSTWIENKLYGRIS
HAFTRF
NT seq 3081 nt   +upstreamnt  +downstreamnt
atgcccctgctctacgtccacgccctgcaggacgtccccgaggaggtgcccagcttccgc
ctgggccagcacctctacggcgcctaccgcacgcggctgcacgagaacgactgggtccgt
atccaggaggacacggggcttctctaccttaaccggagcctggaccacagctcctgggag
aagctcagcattcgcaacggtggcttcccgctgctcaccgtctacctccaggtcttcctg
tcgcccgtgtcccttcgtcagggcgagtgccagtggccgggctgtgcccgagtgtacttc
tccctcatcaacgcctccttcccggcttgtggtgccctcaaaccccgggagctctgcttc
cccgagacgggcctctccttccgcattcgggagaacaggcctcccggcaccttccaccag
ttccgtctgctgcctgtgcaattcctctgccccaacgtcagcgtggcctaccggcttctg
ggaggtgagggtctgcccttccgctgcgctgtggacagcctggaggtgagcacgcgctgg
gccctggaccgcgagcagcgggagaagtatgagctggtggctgtgtgcgcggtgcgcgtc
ggcgcgcgggaggaggaggtgatggtgcccttccccgtgaccgtgtacgacgaagacgac
tctgcgcccagcttcctcgggggcgtcgacaccgccagcgccgtcgtggagttcaagcgg
aaggagggcactgttgcggccacactacgtgtcttcgatgcagatgtggtgccagcaccc
ggggagctcctgaggcggtacacaagcacgctgctctccggggacgcctgggccctccag
accttccgagtagagcactcgcccaacgagaccttggcccaggccaacggcagctttgtg
cgggcaaccgtgcatgactacaggctggttctcaaccggagcctccccatctcggagagc
cgggccgtgcagctggccgtgctggtcaacgactcggacttccagggccccggggagggc
atcctcctcctccacttcaacgtgtccgtgctgcccgtcagcctgcgcctgcccagcacc
tactcctttgccgcgagcaggcgggcccgccgcttcgcccagattgggaaagtctgtgtg
gaaaactgccaggagttcagtggcatccacgtgcagtacaagctgcagctctccagcgcc
aactgcagcgccctggggatggtcacctcggccgaggacaccatggggaccctgttcgtg
aacgacacggaggccctgcagcggcccgagtgtgcccaactccagtacacggtagtggcc
gtcgaacggccaacccgccggcaagcccaggccccactgctcgtcacactggaggggaca
tacgtggcagaggaggcaggctgccccgtgtcctgcgcggtcaacaagaggcggcccgag
tgtgaggaatgcggcggcctgggctctctgacgggcaggtgcgagtggagacagggagac
ggcaaagggatcaccaggaacttctccacctgctcccccagcatcaagacctgccccgat
ggccactgtgacgccgtggaaagcagagacgccaacatctgcccccaggactgcctccgg
ggcggcagcatcattggtgggcacgagcctggggaacgccgggggattaaagccggcttc
ggtatctgcaactgcttcccggaggagaagaagtgcttctgcgagccggaagacagcccg
gacccgctgtgtgacgagctttgccgcacggtgatcgcggcagccgtgctcttctccttc
atcgtgtccgtgctgctgtccaccttctgcatccaccgctaccacaagaacgcccacaag
ccgcccatcgcctcagctgagatgaccttccgccggcccgcccaggcctttcccgtcagc
tactcctcatccggtgcccgccggccctcgctggactccgtggagaaccaggtctctgtg
gacgccttcaagatcccggaggatccaaagtgggaattccctcggaagaacttggttctt
ggaaaaactctgggagaaggagaatttggaaaagtggtcaaggcaacggccttccggctg
aaaggcaaagcggggtacacgactgtggctgtaaagatgctgaaagagaacgcctcggcg
agcgagctgcgggacctgctgtcagagttcaacctcctgacgcaggtcagccacccgcaa
gtcatcaagctgtacggggcctgcagccaggacgggccgctgctcctcatcgtggagtat
gccaagtacggctccctgcggggcttcctccgagagagccgcaaggcggggcccggctat
gtgggcagcagagacagccgcaactccagctacctggacaacccggaggagcgggccctg
accatgggcgacctcatctccttcgcctggcagatctcgcgggggatgcagtacctggcc
gagatgaagctcgtccatcgggacttggcagccagaaacgtcctagtagccgaggggcgc
aggatgaagatctcagattttggtctgtcccgtgatgtttatgaagaggattcctacgtg
aagagaagcaagggtcggatcccagtcaagtggatggccattgagtccctcttcgatcac
atctacaccacccagagtgacgtgtggtccttcggtgtcctgctgtgggagattgtgacc
ctggggggcaacccctaccctgggattcctccagagcggctcttcaaccttctgaagaca
ggctaccggatggagaggccagacaactgcagcgaggagatgtacagtctgatgctgcag
tgctggaaggaggagccagacaagagaccagtgtttgccgacatcagcaaagacctggat
aagatgatggttaagagcagagactacttggacctggccgcgtccaccccatccgactcc
ctgctgtacgacgacggcctgtcggaggaggagatgcccctggtggactgtaataacgct
cccctccctcgcaccctcccctccacgtggattgaaaacaaactctatggtagaatttca
catgcatttactagattctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012683
Entry
103012683         CDS       T03086                                 

Gene name
KIF5B
Definition
(RefSeq) kinesin family member 5B
  KO
K10396  kinesin family member 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04144  Endocytosis
bacu04728  Dopaminergic synapse
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103012683 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    103012683 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103012683 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103012683 (KIF5B)
   05012 Parkinson disease
    103012683 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    103012683 (KIF5B)
   05016 Huntington disease
    103012683 (KIF5B)
   05020 Prion disease
    103012683 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    103012683 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103012683 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103012683 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103012683 (KIF5B)
   04147 Exosome [BR:bacu04147]
    103012683 (KIF5B)
Membrane trafficking [BR:bacu04131]
 Others
  Actin-binding proteins
   Others
    103012683 (KIF5B)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     103012683 (KIF5B)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103012683 (KIF5B)
SSDB
Motif
Pfam: Kinesin Crescentin
Other DBs
NCBI-GeneID: 103012683
NCBI-ProteinID: XP_007196458
UniProt: A0A384BAC6
LinkDB
Position
Un
AA seq 869 aa
MEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLS
VHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQ
ENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTY
VPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVE
LTAEQWKKKYEREKEKNKTLRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFAVDK
DITITNDKPAATIGVTGNFTDSERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQML
DQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTK
EYELLSDELNQKSASLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDV
KQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQIESNKKMEENEKELAACQL
RISQHEAKIRSLTEYLQNVEQKKRQLEESVDSLSEELVQLRAQEKVHEMEKEHLNKVQTA
NEVKQAVEQQIQSHRETHQKQISSLRDEVEAKEKLITDLQDQNQKMALEQGRLRAEHEKL
KAAEQDKSRKLRELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVKKS
AEVDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERV
KALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASP
AHPSAVRGGGASVQNGPPAVRGGGGVKSN
NT seq 2610 nt   +upstreamnt  +downstreamnt
atggagggtaaacttcatgatccagaaggcatgggaattattccaagaatagtgcaagat
atttttaattatatttactccatggatgaaaatttggaatttcatattaaggtttcatat
tttgaaatttatttggacaaaataagggacctgttagatgtttcaaagaccaatctttca
gttcatgaagataaaaaccgagttccctatgtaaaggggtgtacagagcgtttcgtatgt
agtccagatgaagttatggacaccatagatgaaggaaaatccaacagacacgtagcggtt
acaaatatgaatgaacatagctctaggagtcacagtatatttcttattaatgtaaaacaa
gagaacacgcaaacggaacaaaagctgagtggaaaactttatctggttgatttagctggt
agtgaaaaggttagtaaaactggagctgaaggtgctgtgctggatgaagctaagaacatc
aacaagtccctttctgctcttggaaatgtcatttctgctttggctgagggtagtacatat
gttccatatcgagatagtaaaatgacaagaatccttcaagattcattaggtgggaactgt
agaaccactattgtaatttgctgctctccatcatcgtacaatgaatctgaaacaaaatct
acactcctgtttggtcagagggccaaaacaattaagaacacagtttgtgtcaatgtagag
ttaactgcagaacagtggaaaaagaagtatgaaagagaaaaagaaaaaaataagaccctg
cggaacaccattcagtggcttgaaaatgaactcaaccgatggcgtaatggagagacagtg
cctattgatgaacagtttgacaaagagaaagccaacttggaagcttttgcagtggataag
gatattactattaccaatgataaaccagcagccacaattggagttactggaaactttact
gattctgaaagaagaaagtgtgaagaagaaattgctaagttgtacaaacaacttgatgac
aaggatgaagaaattaatcaacagagccaattggtagagaaactgaagacacaaatgttg
gatcaggaagagcttctggcatctaccagaagggatcaagataatatgcaggctgagctg
aatcgtcttcaggcagaaaacgatgcctctaaagaagaagtaaaggaagttttacaagcc
ttagaggaacttgctgtcaactatgatcagaagtctcaggaagttgaagacaaaactaag
gagtatgaattacttagtgacgagctgaatcagaagtcggcaagtttagcaagtatagat
gctgagcttcagaaacttaaggaaatgaccaaccaccagaaaaagcgagcagcagagatg
atggcatctttactaaaagacctggcagaaattgggattgctgtaggaaacaacgacgtg
aagcagcctgagggaactggcatgatagatgaagagttcactgttgcaaggctctacatt
agcaaaatgaagtcagaagtgaaaaccatggtgaagcgctgcaaacagctagaaagcaca
caaattgagagcaacaaaaaaatggaagaaaatgaaaaggagttagcagcatgccagctt
cgtatctctcaacatgaagccaaaatcagatcattgactgaataccttcaaaatgtggag
caaaagaaaagacagctggaggagtctgtggattccctcagtgaagaactcgtccagctt
cgagcacaagagaaagtgcatgaaatggaaaaggagcacttgaataaagttcagactgca
aatgaagttaagcaagctgttgaacagcagatccaaagccacagagaaacgcatcaaaaa
caaattagtagtttgagagatgaagtcgaggcaaaagaaaaacttatcactgatcttcaa
gaccagaaccagaagatggcattggagcaggggcgcctgagagcggagcacgagaagctg
aaagccgcagagcaggacaagagcagaaagctacgggaacttacggttatgcaagataga
cgagaacaagcgagacaagacctgaagggtttggaagagacggtggcgaaggaacttcag
acgttacacaacctgcggaagctctttgttcaggacctggccaccagggttaaaaagagc
gccgaggttgattcggacgacaccggaggcagtgccgctcagaagcagaaaatctccttt
cttgagaataatcttgaacaactcaccaaagtccacaaacagctggtacgtgataacgca
gatcttcgctgtgagcttcctaagctggaaaagcgactcagagctacagctgagagagtg
aaagctttggagtcggcgctgaaagaggccaaagaaaatgcatctcgcgatcgcaaacgc
tatcagcaggaagtagatcgtataaaggaagcagtcaggtcaaagaatatggccagaaga
gggcattctgcacaaattgctaaacctattcgtcctgggcaacatccagcagcttctccg
gctcatcccagtgcagttcgtgggggaggtgcatctgtgcagaacggcccgccggccgtg
cgtggcggaggaggtgttaaaagtaattga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103020972
Entry
103020972         CDS       T03086                                 

Gene name
KIF5A
Definition
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04144  Endocytosis
bacu04728  Dopaminergic synapse
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05020  Prion disease
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05132  Salmonella infection
bacu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103020972 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    103020972 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    103020972 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103020972 (KIF5A)
   05012 Parkinson disease
    103020972 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    103020972 (KIF5A)
   05016 Huntington disease
    103020972 (KIF5A)
   05020 Prion disease
    103020972 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    103020972 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103020972 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103020972 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103020972 (KIF5A)
   04147 Exosome [BR:bacu04147]
    103020972 (KIF5A)
Membrane trafficking [BR:bacu04131]
 Others
  Actin-binding proteins
   Others
    103020972 (KIF5A)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     103020972 (KIF5A)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103020972 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 Spc7
Other DBs
NCBI-GeneID: 103020972
NCBI-ProteinID: XP_007179740
UniProt: A0A383ZX89
LinkDB
Position
Un
AA seq 1032 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYIFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAQDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSNYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLETELSRWRSGEDVPETERLAGEDAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQQELSHLQSENDAA
KDEVKEVLQALEELAMNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDSEDVKKALELQMDSHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKNEEHEKSTKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPYGTRSPECISYTNSLFQNYQNLYLQ
AAPSSTSDMYFANSCTSSGATSSGGPLASYQKANMDNGNATDINDNRSDLPCGYEAEDQA
KLFPLHQETAAS
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggccgagaccaacaacgaatgtagcatcaaggtgctctgccgatttcggcccctaaac
caggccgagattctgcggggggacaagttcatccccattttccaaggggacgacagcgtc
gttattggggggaagccatatatctttgaccgtgtattccccccaaacacgactcaggag
caagtttatcatgcgtgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatttttgcttatggacagacatcctcagggaagacacatactatggagggaaagctg
catgacccccagctgatgggaatcattcctcgaattgcccaagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacatcaaggtttcctactttgagatttacctg
gacaaaatccgtgaccttctggatgtgaccaagacaaatctgtctgtgcacgaggacaag
aaccgggtgccgtttgtcaagggttgtaccgagcgcttcgtgtccagcccagaagaaatt
ttagatgtgattgatgaagggaaatcaaatcgtcatgtggctgtcaccaacatgaatgaa
cacagctctcgaagccatagcatcttcctcatcaatatcaagcaggagaatatggagacc
gagcagaagctcagtgggaagctgtatctagtggacctggcagggagcgagaaggtcagc
aagactggagcagagggagctgtgctggacgaggccaagaatatcaacaagtccctgtca
gccctggggaacgtgatctctgcgctggctgagggcacaaaaagctacgttccttatcgt
gacagcaaaatgacacggattctccaggactccttgggaggaaactgccggacaaccatg
ttcatctgctgctcaccgtccaactacaacgatgcagagaccaagtccaccctgatgttt
ggacagcgggcaaagaccattaagaacactgcctccgtgaatctggagttgactgccgag
cagtggaagaagaaatatgagaaggagaaggagaagacaaaggctcagaaggagacgatt
gcaaagctggagacagagctgagccggtggcgcagtggagaggacgtgccagagacggag
cgcctggctggggaggatgctgccctgggggctgagctctgtgaggagacgcccgtgaac
gacaactcatccatcgtggtgcgcatcgcgcctgaggagcggcagaagtacgaggaggag
atccgccgcctctacaagcagcttgatgacaaggatgatgagatcaaccagcagagccaa
ctcatagagaagctcaagcagcagatgctggaccaggaagagctgctggtgtccactcga
ggagacaatgagaaggtccagcaggagctgagccacctgcagtcggagaacgacgccgcg
aaggatgaggtgaaggaagtgctgcaggcactggaggagctggccatgaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagcttctggtggatgagctgtct
cagaaggtggccaccatgctgtccctggagtctgagttgcagcggctacaggaggtcagt
ggacaccagcggaaacgaattgctgaggtgctgaacgggctgatgaaggacctgagtgag
ttcagtgtcatcgtgggcaacggggagattaagctgccggtggagatcagcggggccatc
gaggaggagttcactgtggcccgactctacatcagcaaaatcaaatccgaagtcaagtct
gtggttaaacggtgccggcagctagagaacctccaggtcgaatgtcaccgcaagatggaa
gtgactggacgggagctctcatcctgccagcttctcatctcccagcatgaggccaagatc
cgctccctgacggaatacatgcagagcgtggagctcaagaagcggcacctggaagagtcc
tatgactccctgagtgatgagctggccaagctccaagcccaggaaactgtgcatgaagtg
gccctgaaggataaggagccagacacacaggactccgaagatgtgaagaaggccctggag
ctgcagatggacagccaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaatgagaagcagaagaccattgatgagctcaaagacctgaatcagaagctccagtta
gagctggagaagcttcaggctgactatgagaagctgaagaatgaagaacatgagaaaagc
accaaactccaggagctgacatttctgtatgagcgacacgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgggaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaag
ctggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaggacaagcgccggtaccagcaggaggtggaccgcatc
aaggaggccgttcggtacaagagctctggcaaacggggccattctgcccagattgccaaa
cccgtccggcctggccactacccagcatcttcacctaccaacccctatggcacccggagc
cctgagtgcatcagttacactaacagcctcttccagaactaccagaatttgtacctgcag
gctgcacctagctccacctcagatatgtactttgcaaactcctgtaccagcagtggggcc
acatcttctggaggccccttggcttcctaccagaaggccaacatggacaatggaaatgcc
acagatatcaatgacaataggagtgacctgccatgcggctacgaggctgaagaccaggcc
aagctgttccctctccaccaagagacggcagccagctaa

DBGET integrated database retrieval system