KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004158
Entry
103004158         CDS       T03086                                 

Definition
(RefSeq) neuroendocrine secretory protein 55-like
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04024  cAMP signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04724  Glutamatergic synapse
bacu04726  Serotonergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05012  Parkinson disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05034  Alcoholism
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103004158
   04020 Calcium signaling pathway
    103004158
   04072 Phospholipase D signaling pathway
    103004158
   04024 cAMP signaling pathway
    103004158
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103004158
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103004158
  09152 Endocrine system
   04911 Insulin secretion
    103004158
   04922 Glucagon signaling pathway
    103004158
   04923 Regulation of lipolysis in adipocytes
    103004158
   04912 GnRH signaling pathway
    103004158
   04913 Ovarian steroidogenesis
    103004158
   04915 Estrogen signaling pathway
    103004158
   04921 Oxytocin signaling pathway
    103004158
   04926 Relaxin signaling pathway
    103004158
   04935 Growth hormone synthesis, secretion and action
    103004158
   04918 Thyroid hormone synthesis
    103004158
   04928 Parathyroid hormone synthesis, secretion and action
    103004158
   04916 Melanogenesis
    103004158
   04924 Renin secretion
    103004158
   04925 Aldosterone synthesis and secretion
    103004158
   04927 Cortisol synthesis and secretion
    103004158
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103004158
   04270 Vascular smooth muscle contraction
    103004158
  09154 Digestive system
   04970 Salivary secretion
    103004158
   04971 Gastric acid secretion
    103004158
   04972 Pancreatic secretion
    103004158
   04976 Bile secretion
    103004158
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103004158
   04961 Endocrine and other factor-regulated calcium reabsorption
    103004158
  09156 Nervous system
   04724 Glutamatergic synapse
    103004158
   04728 Dopaminergic synapse
    103004158
   04726 Serotonergic synapse
    103004158
   04730 Long-term depression
    103004158
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103004158
  09159 Environmental adaptation
   04713 Circadian entrainment
    103004158
   04714 Thermogenesis
    103004158
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004158
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103004158
  09165 Substance dependence
   05030 Cocaine addiction
    103004158
   05031 Amphetamine addiction
    103004158
   05032 Morphine addiction
    103004158
   05034 Alcoholism
    103004158
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103004158
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103004158
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103004158
   05165 Human papillomavirus infection
    103004158
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103004158
   05142 Chagas disease
    103004158
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103004158
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103004158
   04031 GTP-binding proteins [BR:bacu04031]
    103004158
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103004158
  Exosomal proteins of other body fluids (saliva and urine)
   103004158
  Exosomal proteins of colorectal cancer cells
   103004158
  Exosomal proteins of bladder cancer cells
   103004158
GTP-binding proteins [BR:bacu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103004158
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 103004158
NCBI-ProteinID: XP_007185298
UniProt: A0A384ADB9
LinkDB
Position
Un
AA seq 244 aa
MDRRSRAQQGRRARHGYNDLCPPLGRRAATALLWLSCSIALLRALATSSARAQQRAAAQR
RSFLNAHHRSAAQVFPEPPESDHEHDEADLELSLPECLEYEEEFDYESETETESEIESET
DFETEPETAPAPQPETEPEDERGPVVPKRRTFDQSLTERLNALRLQSPDASPSRAQPSTR
ESVSPRQGEEPEPEDKDPRDPEESEQPEEEEKQRRRRCKPKKPTRRDPSPESPSKRGPIP
IRRH
NT seq 735 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcccgagctcagcaagggcgccgagctcgccacggttacaacgatctg
tgcccacccctaggccgccgggcagccaccgccctcctctggctctcctgctccatcgcg
ctccttcgcgcccttgccacctccagcgcccgcgcccagcagcgcgcggctgcccagcgc
cggagcttccttaacgcccaccaccgctccgccgcccaggtattccccgagcccccagaa
tccgaccacgagcacgacgaggcagacctcgagctctccctccccgagtgcctggagtac
gaggaagagttcgactacgaatccgagaccgagaccgagtctgaaatcgagtcggagacc
gacttcgagaccgagcctgagaccgcccccgcccctcagcccgagaccgagcccgaggac
gagcgcggccccgtggtgcccaagcgccgcaccttcgaccagtctctcactgagcgtctc
aacgccctgaggttgcagagccccgacgcctccccgagtcgcgcgcagcccagcactcgg
gagtctgtgagccccagacaaggggaggagcccgagccggaggacaaggatccgagggac
cccgaggagtccgagcagccagaggaggaggagaagcagcggcggcgccgttgcaagccg
aagaagcccacccgccgcgacccatctccggagtctccttccaaaaggggacccatcccc
atccggcgtcactaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004432
Entry
103004432         CDS       T03086                                 

Gene name
GNAS
Definition
(RefSeq) GNAS complex locus
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04024  cAMP signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04540  Gap junction
bacu04611  Platelet activation
bacu04713  Circadian entrainment
bacu04714  Thermogenesis
bacu04724  Glutamatergic synapse
bacu04726  Serotonergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04913  Ovarian steroidogenesis
bacu04915  Estrogen signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04921  Oxytocin signaling pathway
bacu04922  Glucagon signaling pathway
bacu04923  Regulation of lipolysis in adipocytes
bacu04924  Renin secretion
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04927  Cortisol synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu04935  Growth hormone synthesis, secretion and action
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04962  Vasopressin-regulated water reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04976  Bile secretion
bacu05012  Parkinson disease
bacu05030  Cocaine addiction
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05034  Alcoholism
bacu05142  Chagas disease
bacu05146  Amoebiasis
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103004432 (GNAS)
   04020 Calcium signaling pathway
    103004432 (GNAS)
   04072 Phospholipase D signaling pathway
    103004432 (GNAS)
   04024 cAMP signaling pathway
    103004432 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103004432 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103004432 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    103004432 (GNAS)
   04922 Glucagon signaling pathway
    103004432 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    103004432 (GNAS)
   04912 GnRH signaling pathway
    103004432 (GNAS)
   04913 Ovarian steroidogenesis
    103004432 (GNAS)
   04915 Estrogen signaling pathway
    103004432 (GNAS)
   04921 Oxytocin signaling pathway
    103004432 (GNAS)
   04926 Relaxin signaling pathway
    103004432 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    103004432 (GNAS)
   04918 Thyroid hormone synthesis
    103004432 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    103004432 (GNAS)
   04916 Melanogenesis
    103004432 (GNAS)
   04924 Renin secretion
    103004432 (GNAS)
   04925 Aldosterone synthesis and secretion
    103004432 (GNAS)
   04927 Cortisol synthesis and secretion
    103004432 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103004432 (GNAS)
   04270 Vascular smooth muscle contraction
    103004432 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    103004432 (GNAS)
   04971 Gastric acid secretion
    103004432 (GNAS)
   04972 Pancreatic secretion
    103004432 (GNAS)
   04976 Bile secretion
    103004432 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    103004432 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103004432 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    103004432 (GNAS)
   04728 Dopaminergic synapse
    103004432 (GNAS)
   04726 Serotonergic synapse
    103004432 (GNAS)
   04730 Long-term depression
    103004432 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103004432 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103004432 (GNAS)
   04714 Thermogenesis
    103004432 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004432 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    103004432 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    103004432 (GNAS)
   05031 Amphetamine addiction
    103004432 (GNAS)
   05032 Morphine addiction
    103004432 (GNAS)
   05034 Alcoholism
    103004432 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    103004432 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103004432 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103004432 (GNAS)
   05165 Human papillomavirus infection
    103004432 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103004432 (GNAS)
   05142 Chagas disease
    103004432 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    103004432 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103004432 (GNAS)
   04031 GTP-binding proteins [BR:bacu04031]
    103004432 (GNAS)
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103004432 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103004432 (GNAS)
  Exosomal proteins of colorectal cancer cells
   103004432 (GNAS)
  Exosomal proteins of bladder cancer cells
   103004432 (GNAS)
GTP-binding proteins [BR:bacu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    103004432 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA GTP_EFTU AAA_29 TniB
Other DBs
NCBI-GeneID: 103004432
NCBI-ProteinID: XP_007185299
UniProt: A0A384ADE1
LinkDB
Position
Un
AA seq 394 aa
MGCLGNSKTEDQRNEEKAQREANKKIEKQLQKDKQVYRATHRLLLLGAGESGKSTIVKQM
RILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVELA
NPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFLD
KIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFND
VTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAEK
VLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYCY
PHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgggctgcctcggaaacagtaagaccgaggaccagcgcaacgaggagaaggcgcagcgc
gaggccaacaaaaagatcgagaagcagctgcagaaggacaagcaggtctaccgggccacg
caccgcctgctgctgctgggtgctggagaatctggtaaaagcaccatcgtgaagcaaatg
aggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggctgca
aggagcaacagcgatggtgagaaggccaccaaagtgcaggacatcaaaaacaacctgaaa
gaagccattgaaaccatcgtggccgccatgagcaacctggtcccccccgtggagctggcc
aaccccgagaaccagttcagagtggactacatcctgagcgtgatgaacgtgccagacttc
gatttccctcccgaattctacgagcacgccaaggctctgtgggaggacgagggggtgcgt
gcctgctacgagcgctccaacgagtaccagctcattgactgcgcgcagtacttcctggac
aagattgacgtcatcaagcaggctgactacgtgcccagcgaccaggacctgctgcgctgc
cgcgtcctgacttctggaatctttgagaccaagttccaggtggataaagtcaacttccac
atgtttgacgtgggcggccagcgtgatgaacgccgcaaatggatccagtgcttcaatgat
gtgactgccatcatcttcgtggttgccagcagcagctacaacatggtcatccgggaagac
aaccagaccaaccgcctgcaggaggccctgaacctcttcaagagcatctggaacaacaga
tggctgcgcaccatctctgtgattctgttcctcaacaagcaagatctgctcgctgagaaa
gtccttgctggaaaatcgaagattgaggactactttccagaatttgctcgctacactact
cctgaggatgcgactcccgagcccggagaggacccacgcgtgacccgggccaagtacttc
attcgagatgaatttctgagaatcagcactgctagtggagacgggcgccactattgctac
cctcacttcacctgcgctgtggacacagagaacattcgccgtgtgttcaacgactgccgt
gacatcatccagcgcatgcacctccgtcagtatgagctgctctaa

DBGET integrated database retrieval system