KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004366
Entry
103004366         CDS       T03086                                 

Gene name
EGF
Definition
(RefSeq) epidermal growth factor
  KO
K04357  epidermal growth factor
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04630  JAK-STAT signaling pathway
bacu04810  Regulation of actin cytoskeleton
bacu05160  Hepatitis C
bacu05165  Human papillomavirus infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05226  Gastric cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103004366 (EGF)
   04012 ErbB signaling pathway
    103004366 (EGF)
   04014 Ras signaling pathway
    103004366 (EGF)
   04015 Rap1 signaling pathway
    103004366 (EGF)
   04630 JAK-STAT signaling pathway
    103004366 (EGF)
   04066 HIF-1 signaling pathway
    103004366 (EGF)
   04068 FoxO signaling pathway
    103004366 (EGF)
   04020 Calcium signaling pathway
    103004366 (EGF)
   04072 Phospholipase D signaling pathway
    103004366 (EGF)
   04151 PI3K-Akt signaling pathway
    103004366 (EGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103004366 (EGF)
   04540 Gap junction
    103004366 (EGF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103004366 (EGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004366 (EGF)
   05231 Choline metabolism in cancer
    103004366 (EGF)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103004366 (EGF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103004366 (EGF)
   05212 Pancreatic cancer
    103004366 (EGF)
   05226 Gastric cancer
    103004366 (EGF)
   05214 Glioma
    103004366 (EGF)
   05218 Melanoma
    103004366 (EGF)
   05219 Bladder cancer
    103004366 (EGF)
   05215 Prostate cancer
    103004366 (EGF)
   05213 Endometrial cancer
    103004366 (EGF)
   05224 Breast cancer
    103004366 (EGF)
   05223 Non-small cell lung cancer
    103004366 (EGF)
  09172 Infectious disease: viral
   05160 Hepatitis C
    103004366 (EGF)
   05165 Human papillomavirus infection
    103004366 (EGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103004366 (EGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bacu04052]
    103004366 (EGF)
Cytokines and growth factors [BR:bacu04052]
 Growth factors
  Growth factors (RTK binding)
   103004366 (EGF)
SSDB
Motif
Pfam: Ldl_recept_b FXa_inhibition cEGF EGF_CA EGF EGF_3 DUF5050 Plasmod_Pvs28 Tr-sialidase_C
Other DBs
NCBI-GeneID: 103004366
NCBI-ProteinID: XP_007191093
UniProt: A0A384AUY0
LinkDB
Position
Un
AA seq 1215 aa
MLLFLIILLPVVFKFSFVSLSALQRWSCPEAAPSGNGNSTCVGPAPFLIFSHGNRIFRID
LEGTNHEQLVADAGISMIMDFHYSEERIYWVDLERQLLQRVFLNGTSQEKICQIEKNVSG
MAINWINEELIWSNQQEGIITVTDMKGNNSRVLLSALKYPANIAVDPVERFMFWSSEVAG
SLHRADLGGVEVKLLLETSEKITAVSLDVLDKRLFWIQYHRERSNSRICSCDYDGGSAHF
SKHSTQHNFFAMSLFGDRIFYSTWKKKTIWIANKHTGKNMVKINLSPSLVPPGGIKVVHP
LVQPKAEGDPWVPDQKLCKLRKANCRSSMCGQEPKSHVCMCAEGYALSQDGKNCEDVNEC
AFWNHGCTLGCENIPGSYYCTCPVGFVLLPDGKRCHQLISCPSNVSECSHDCVLTSDGPI
CFCPEGSVLETDGKTCSGCSSPDNGGCSQLCIPLSPVSWECGCIPGYDLQLDKKSCTASG
PPPFLLFANSQDIRHVRFDGTDYGTLLSQQIGMVFALDHDPVENKIYFAHTALKWIERAN
TDGSQRERLIEEEVGVPEGLAVDWIGRKFYWTDRGKSLIEGSDLNGKYREIIIKEGISQP
RGLAVHPMAKRLFWTEMGINPRIESSSLQGIGRLVIASSDLVWPSGITIDYLTDKLYWCD
AKQSVIEMSNLDGSKRQRLVQNDVGHPFAVAVFEDHVWFSDWTMPSVIRVNKRTGKNRVR
LRGSMLKPSSLVVVHPLAKPGADPCLLQNGGCEHICEERFGTAQCLCREGFVKAPDGKTC
LALNGHQILAVGSGADLSNGVIPLDILPSSRELEDNITESQHTLVAEIMVSDDDECGALG
CSTQAWCVSEGENVTCRCLKGFAGDGKLCSDIDECQLGISVCPPTSSKCINTEGGHVCRC
SEGYQGDGIHCLDIDECQLGMHTCGENAACTNTEGNYTCTCAGNLSEPGRICPDSTPPSH
PREDGRSSVRNIYPECPPSHDGYCLHGGVCMYLEAVDSYACNCVVGYVGERCQHRDLKWW
ELRHAGRGRQRSVTAVVVCVVVLVLLLLLGLCGAQRYRTQKLLSKNPKNPYDESSRDVSS
VRPADDEAGMSSCPQPWFVVIKEHQNFSNGSQPVALKDGLVADVGQFSSLEPGSLQPTSW
RKEPQMYMATEQGCCVSSSSDKGSSHQRMKCSFHLPSYGPWPIAGGVEKSHSLPSAYPLW
QQRAPDPPHQMELTQ
NT seq 3648 nt   +upstreamnt  +downstreamnt
atgctgctgttccttatcattctgttgccggtagtttttaaatttagttttgttagcctc
tcagcactgcagcgctggagctgtcctgaagctgctccctcgggaaacgggaattctact
tgtgtgggtcctgcacccttcttaattttctcccatggaaacaggatctttaggattgac
ttagaaggaactaatcatgagcaattggtggcagatgctggcatatccatgatcatggat
tttcattacagtgaagaaagaatctattgggtcgatctagaaagacaacttttgcaaaga
gtttttctgaatgggacaagccaagagaaaatatgccagatagagaaaaatgtttcagga
atggcaataaattggatcaatgaagaacttatttggtcaaatcaacaggaaggaatcatt
acagtaacagatatgaaaggaaacaattcccgcgttctcttaagcgccttaaaatatcct
gcaaatatagcagttgatccagtagaaaggtttatgttttggtcttcagaggtggcgggc
agccttcacagagcagatctcggtggtgtggaagtgaagcttctgttagagacatcagag
aaaataacagctgtgtcattggatgtgcttgataaacggctcttttggattcagtaccat
agagaaagaagcaattctcgtatttgttcctgtgattacgatggaggttccgcccatttt
agcaaacatagcacacagcacaatttttttgcgatgtccctttttggtgatcgtattttc
tattcaacatggaaaaagaagacaatttggatagctaacaagcacactgggaagaatatg
gttaaaattaacctcagtccatcacttgtaccacctggtggaattaaagtagtgcatcca
ctcgtacagcccaaggcagagggtgatccttgggtacctgatcagaaactctgcaaactg
aggaaagctaactgcagaagcagcatgtgtgggcaagagcctaagtcccatgtgtgcatg
tgtgcagagggatatgctttaagccaagatggaaagaactgtgaagatgtcaacgagtgt
gccttttggaatcatggctgtactcttgggtgtgaaaacatccctggatcctattattgc
acatgccctgtaggatttgttctgcttcctgatgggaaacggtgtcaccaattaatttcc
tgcccaagtaatgtgtctgaatgcagtcatgattgtgttctgacatcagacggtcccata
tgtttctgtcctgaaggctcagtgcttgagacagatgggaaaacctgtagtggttgttca
tctcccgataatggtggatgtagccagctctgcattcctctcagcccagtgtcctgggaa
tgtggctgcattccggggtatgacctacaactggacaaaaagagctgtacagcctcagga
ccaccaccgtttttgctgtttgccaattctcaggatattcgacacgtgcgttttgatgga
acagattatggaaccctgctcagccagcaaataggaatggtttttgccctagatcatgac
cctgtggaaaataagatatactttgcccatacagccctaaagtggatagagagagcaaat
acggatggttcccagcgagaaaggcttattgaggaagaagtaggtgtgccagaaggtctt
gctgtcgactggattggccgtaagttctattggacagacagagggaaatctctcattgaa
gggagtgatttaaatgggaagtatcgtgaaataatcattaaggagggcatctctcagcca
cgaggacttgctgttcatccaatggccaagagattattctggactgagatggggattaat
ccacgaattgaaagttcttcccttcaaggcattggccgactggttatagctagctcggat
ctggtctggcccagtggaataacaattgattacttaactgacaagttgtattggtgcgat
gccaagcagtctgtgattgaaatgtccaatctggatggttcaaaacgccaaagacttgtc
cagaacgatgtaggtcacccatttgctgtggctgtgtttgaggatcatgtgtggttctct
gattggactatgccatcggtaataagggtgaacaagaggactggcaaaaatagggtacgt
ctccgaggcagcatgctgaagccctcatcactggttgtagttcatccattggcaaaacca
ggagcagatccctgcttacttcaaaacggaggctgtgaacatatttgcgaagagaggttt
ggaactgctcagtgtttgtgtcgtgaaggttttgtgaaagctccagatggaaaaacgtgt
ctggctctgaatggccatcagatattggcagtaggtagtggagcagatctgagtaatgga
gtaataccgttggacatcttacccagcagtagagagcttgaagataatattacagaatct
caacatacgctagtggctgaaatcatggtgtcagatgatgatgagtgtggtgccttggga
tgcagtacacaggcttggtgtgtttcagagggagagaatgtcacgtgtcggtgtttgaaa
ggatttgccggagatggaaaactgtgttctgatatagatgaatgtcagctgggtatctca
gtttgccctcccacctcctccaagtgcatcaatactgaaggtggccacgtctgccgatgc
tcagaaggctaccagggagatgggatccactgcctcgatattgatgagtgccaactgggc
atgcacacctgtggggaaaatgctgcctgtacaaatacagagggaaactacacctgcaca
tgtgctggcaacttgtctgaacctggacggatttgccctgactcgactccaccatctcat
cccagggaggatggccgctcttctgtgagaaatatttaccccgaatgtcccccgtcccat
gatgggtactgcctccacggcggtgtgtgtatgtatcttgaagcagtcgacagctatgcc
tgcaactgtgtcgttggctacgtcggggagcggtgtcagcaccgagacctgaagtggtgg
gagctgcgtcatgccggccgcgggcggcagcggagcgtcaccgcggtggtcgtctgcgtg
gtggtgctggtcctgctactgctcttggggctgtgcggggctcagagatacaggactcag
aagctgctatcgaaaaatccaaagaatccttatgacgagtcgagcagagatgtgagcagt
gtcaggcctgcagatgacgaggctgggatgtcctcttgcccccaaccttggtttgtggtt
ataaaggaacatcaaaacttcagcaatgggagtcaacctgtagccctcaaggacggtctg
gtggcagatgttggccagttttcttccctggagcctgggtcattgcaaccaacatcatgg
agaaaggagccccagatgtatatggccacagaacaaggatgctgtgtttcatcatccagt
gataaaggctctagtcaccagagaatgaagtgtagctttcatctcccctcctatgggcca
tggcccattgctgggggagttgagaagtcccattctctcccgtcagcttacccattatgg
caacaaagagctccggatccaccacaccaaatggagctgactcagtga

DBGET integrated database retrieval system