KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004460
Entry
103004460         CDS       T03086                                 

Gene name
MTOR
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu01522  Endocrine resistance
bacu04012  ErbB signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04136  Autophagy - other
bacu04140  Autophagy - animal
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04152  AMPK signaling pathway
bacu04211  Longevity regulating pathway
bacu04213  Longevity regulating pathway - multiple species
bacu04218  Cellular senescence
bacu04371  Apelin signaling pathway
bacu04613  Neutrophil extracellular trap formation
bacu04630  JAK-STAT signaling pathway
bacu04659  Th17 cell differentiation
bacu04714  Thermogenesis
bacu04910  Insulin signaling pathway
bacu04919  Thyroid hormone signaling pathway
bacu04920  Adipocytokine signaling pathway
bacu04930  Type II diabetes mellitus
bacu04931  Insulin resistance
bacu04935  Growth hormone synthesis, secretion and action
bacu05010  Alzheimer disease
bacu05014  Amyotrophic lateral sclerosis
bacu05016  Huntington disease
bacu05017  Spinocerebellar ataxia
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05168  Herpes simplex virus 1 infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05221  Acute myeloid leukemia
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05230  Central carbon metabolism in cancer
bacu05231  Choline metabolism in cancer
bacu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103004460 (MTOR)
   04371 Apelin signaling pathway
    103004460 (MTOR)
   04630 JAK-STAT signaling pathway
    103004460 (MTOR)
   04066 HIF-1 signaling pathway
    103004460 (MTOR)
   04072 Phospholipase D signaling pathway
    103004460 (MTOR)
   04151 PI3K-Akt signaling pathway
    103004460 (MTOR)
   04152 AMPK signaling pathway
    103004460 (MTOR)
   04150 mTOR signaling pathway
    103004460 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103004460 (MTOR)
   04136 Autophagy - other
    103004460 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    103004460 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103004460 (MTOR)
   04659 Th17 cell differentiation
    103004460 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103004460 (MTOR)
   04920 Adipocytokine signaling pathway
    103004460 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    103004460 (MTOR)
   04919 Thyroid hormone signaling pathway
    103004460 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    103004460 (MTOR)
   04213 Longevity regulating pathway - multiple species
    103004460 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    103004460 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004460 (MTOR)
   05206 MicroRNAs in cancer
    103004460 (MTOR)
   05205 Proteoglycans in cancer
    103004460 (MTOR)
   05230 Central carbon metabolism in cancer
    103004460 (MTOR)
   05231 Choline metabolism in cancer
    103004460 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103004460 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103004460 (MTOR)
   05212 Pancreatic cancer
    103004460 (MTOR)
   05225 Hepatocellular carcinoma
    103004460 (MTOR)
   05226 Gastric cancer
    103004460 (MTOR)
   05214 Glioma
    103004460 (MTOR)
   05221 Acute myeloid leukemia
    103004460 (MTOR)
   05215 Prostate cancer
    103004460 (MTOR)
   05224 Breast cancer
    103004460 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103004460 (MTOR)
   05014 Amyotrophic lateral sclerosis
    103004460 (MTOR)
   05016 Huntington disease
    103004460 (MTOR)
   05017 Spinocerebellar ataxia
    103004460 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    103004460 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103004460 (MTOR)
   04931 Insulin resistance
    103004460 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103004460 (MTOR)
   05168 Herpes simplex virus 1 infection
    103004460 (MTOR)
   05163 Human cytomegalovirus infection
    103004460 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103004460 (MTOR)
   05165 Human papillomavirus infection
    103004460 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103004460 (MTOR)
   01522 Endocrine resistance
    103004460 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103004460 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103004460 (MTOR)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103004460 (MTOR)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   103004460 (MTOR)
Membrane trafficking [BR:bacu04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    103004460 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 103004460
NCBI-ProteinID: XP_007170054
UniProt: A0A383Z591
LinkDB
Position
Un
AA seq 2546 aa
MLGTGPAAAAAATTASSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAMQPQQSNALVGLLGYSSHQGLMGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIASEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNVATAATTAATATATSTEGSNSESEAESAENSPT
PSPLQKKVTEDLSKTLLMYTVPAVQGFFRXLSQGNNLQDTLRVLTLWFDYGHWPDVNEAL
VEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKST
TTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGERN
VKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDL
YYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPVVRIQSIAPSLQVI
TSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQ
RYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQK
VEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSN
LMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTV
MEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVEL
GEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPT
QVELLIKQATSHENLCQCYIGWCPFW
NT seq 7641 nt   +upstreamnt  +downstreamnt
atgcttggaaccggccctgccgccgctgccgcagctaccacggcatccagcaatgtgagc
gtcctgcagcagtttgccagcggcctgaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggagctccgagagatgagtcaagaagagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaac
gccacccgaatcggaagatttgctaactaccttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccatcggtcgcctcgccatggcaggggacactttt
accgcggagtatgtggagtttgaggtgaagcgagccttggaatggctgggtgctgaccgc
aacgagggccggagacatgcggctgtcctggttcttcgtgagctggccatcagcgttccc
accttcttcttccagcaagtgcagcccttctttgacaatatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgttgccgcccttcgtgcctgtctgatcctcacc
acccagcgggagccgaaggagatgcagaagccacagtggtacaggcacacgtttgaggaa
gcagagaaagggtttgacgagaccttggccaaggagaagggcatgaatcgcgatgatcgg
atccacggagccttactaatcctcaacgagctggttcgcatcagcagcatggagggggag
cgcctgagagaagaaatggaagaaatcacacagcagcagttggtacatgacaagtactgc
aaggatctcatgggcttcggaacgaaacctcgtcacatcacccccttcaccagtttccag
gccatgcaaccccagcagtcaaacgccttggtgggactgctggggtacagctctcaccaa
ggccttatgggcttcggggcttcccccagcccagcgaagtccaccctggtggagagtcgc
tgctgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatcctgaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacggacagcagccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgcctcctaaggactttgcccataagagacagaaggcaatgcaggtggatgcc
acagtgttcacctgcatcagcatgctggcccgagcgatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgctggcggtgggactgagccctgccctcacagctgtg
ctctacgacctgagccgtcagattccacagctgaaaaaggacatccaagatggactcctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacgaccctccctgaggccagcgatgtgggc
agcattacccttgccctccgaactcttggcagttttgaatttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgctcacgccttccgtccacctcatcagtggccac
gctcacgtggttagccagaccgcagtgcaagtggtggcggatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccccgacatccgctactgtgtcttggcatccctggat
gagcgctttgacgcacacctggcccaggcagagaatctgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattggaagaatcaaggaacagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagagttggctcaggttagtggcctagaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctacgtggtggagccctacaggaag
taccccacattgcttgaggtgctgctgaatttcctgaagactgagcagaaccagggtaca
cggcgagaggctatccgtgtgttagggctcttgggggccttggatccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggatgcttctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagtgagatgctggtcaacatgggaaac
ctgcctctggacgagttctacccagccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctctcaccatcacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgggtttgtgacggagccatccgggaatttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcaggccttacatggatgaaatagtcacactcatgagagaa
ttctgggtcatgaacacctccatccagagcacgatcattcttctcattgagcagattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctacga
gtcttcatgcatgacaatagcccaggccgcatcgtctccatcaagttgcttgctgcaatc
cagctgtttggcgccaacctggatgactatctgcatttgttgttgccccctatcgtgaag
ttgtttgatgcccctgaagttccattgccatctcgaaaggcagcgttagagacagtggac
cgcctgacggagtccctggatttcactgactatgcctctcggatcattcacccgattgtg
cgaacgctggaccagagcccagaactccgtcccacagccatggacacgttgtcctcactc
gtttttcagctggggaagaagtaccaaattttcattccaatggtaaataaagttctggtg
cgacaccgaatcaaccatcagcgctacgatgtcctcatctgcaggattgtcaagggatac
acccttgctgatgaagaagaggaccctttgatttaccagcatcgaatgctgcggagtggc
caaggggatgccttggctagcggaccagtggaaacgggacccatgaagaaactgcacgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ttggaatggctgaggcggctgagcctggagctgctgaaggactcctcatcaccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaacgct
gcgtttgtgtcctgctggtctgagctgaatgaagaccagcaggatgagctcatcagaagc
atcgagctggccctcacctcccaggacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccattgagagatgacaatggcatt
gttctgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctacactacaaa
gaactggagttccagaaaggtcccacccctgccatcctagaatctctcatcagcattaat
aataagctacagcagccagaggcagctgccggggtattagaatatgccatgaaacacttc
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgctctt
gtggcctatgataagaaaatggacaccaacaaggatgacccggagctgatgctgggccgc
atgcgctgcctcgaggccctgggggaatgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagccgca
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatccctcgggatacc
cacgacggggcattttacagagccgtgctggcactgcatcaggacctcttctccttggcg
cagcagtgcatcgacaaagcccgggacctgctggacgccgagttaactgcgatggcagga
gagagctacagccgggcgtatggggccatggtttcttgccacatgctctccgagctggag
gaggtcatccagtacaaacttgtccccgagcgccgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtgcgg
tcgctagtggtcagccctcacgaggacatgaggacctggctcaagtatgcaagcctgtgt
ggcaagagtggcaggctggctcttgctcataaaaccttagtgctgctcctgggagttgat
ccgtctcggcaacttgaccaccctctgccaacagttcacccccaggtgacctacgcctac
atgaaaaatatgtggaagagcgctcgcaagatcgatgccttccagcacatgcagcacttt
gttcagaccatgcagcagcaagcccagcacgccatcgccagcgaggaccagcagcacaag
caggagctgcacaagcttatggcccgctgtttcctgaaactcggggagtggcagctgaac
ctgcagggcatcaacgagagcacgatccccaaagtcctgcaatattatagcgccgccacg
gagcacgaccgcagctggtacaaggcctggcacgcgtgggctgtgatgaacttcgaggct
gtgctccactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgtcacgcc
agcggggccaacatcaccaacgtggccactgccgccaccacggcggccacggccactgcc
accagcaccgagggtagtaacagcgagagcgaggctgagagcgctgagaacagccctacc
ccatctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatgtacacc
gtccctgctgtccagggcttcttccgtnctttgtcacaaggcaacaacctccaggacacg
ctcagagtcctcaccttatggtttgattatggtcactggccagatgtaaacgaagcctta
gtggaaggggtgaaagcgatccagattgacacttggttacaggttatacctcagctcatt
gcgagaattgatacgccgaggcccttggtgggacgtctcattcaccagcttctcacagac
attggtcggtaccacccccaggccctcatctacccgctgacggtggcttctaagtctacc
accacggcccgtcacaatgcggccaacaagattctgaagaacatgtgcgagcacagtaac
accttggtgcaacaggccatgatggtgagtgaggagctgatccgagtggccattctgtgg
catgagatgtggcacgaaggcctggaagaggcttctcgcttgtactttggggagaggaac
gtgaaaggcatgttcgaggtgctggagcccctgcatgctatgatggagcggggaccgcag
actctgaaggaaacatcctttaaccaggcgtatggtcgagatttaatggaggcccaggag
tggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcctgggacctc
tattaccacgtgttcagacgaatctcaaagcagctgcctcagctcacatccctagagctg
caatacgtgtccccaaagcttctgatgtgccgggacctggaattggctgtgccgggaacg
tacgaccccaaccagccggtcgttcgcattcagtccattgcaccgtctctacaagtcatc
acatccaagcagaggccccggaagctgacgcttatgggcagcaacgggcacgagtttgtc
ttcctcctgaagggccatgaagatctgcggcaggacgagcgagtgatgcagctcttcggc
ctggtcaacacccttctggccaatgacccaacatctcttcggaaaaacctcagcatccag
agatatgctgtcattcccttatcaaccaattcgggcctcatcggctgggtcccccactgt
gacacgctgcacgccctcatccgggactacagggagaaaaagaagatccttctcaacatc
gagcatcgcatcatgctgcggatggctccggactacgaccacctgactctgatgcagaag
gttgaggtgtttgagcacgccgtcaacaacacggctggggacgacctggccaagctgctg
tggctgaagagccccagctccgaggtgtggtttgatcgaagaaccaattacacccgctct
ttagcggtcatgtccatggttgggtatattttgggcctgggtgatagacacccatccaac
ctgatgctggaccggctgagcgggaagatcctgcacattgactttggggactgctttgag
gttgctatgaccagagagaaattcccagagaagattccatttagactaacaagaatgttg
accaatgctatggaggtcacgggcctggatggcaactacagaatcacatgccacacggtg
atggaagtgcttcgggagcacaaggacagcgtcatggccgtgctggaagccttcgtctat
gaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaagcgatcacga
acgaggacagattcctactctgctggccagtcagtagaaattttggatggtgtggaactt
ggggaaccagcccataagaaaacggggaccacagtgccagaatctattcattctttcatt
ggagacggtttggtgaaaccagaggccctaaataagaaagctattcaaattattaacaga
gttcgagataagctcactggtcgggacttctctcacgatgaaacgctggatgtcccaaca
caagttgagctgctcatcaaacaggcaacatcccatgaaaacctctgccagtgctacatc
ggctggtgtcctttctggtaa

DBGET integrated database retrieval system