KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004480Help
Entry
103004480         CDS       T03086                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu03013  RNA transport
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103004480 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bacu03012]
    103004480 (EIF3A)
Translation factors [BR:bacu03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    103004480 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 103004480
NCBI-ProteinID: XP_007173236
UniProt: A0A383ZDU9
LinkDB All DBs
Position
Un
AA seq 1364 aa AA seqDB search
MPAYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLSQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYNKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSXXXXXLSIPITPERTDIARLLDMDGIIVEKQRRLATLLGLQ
APPTRIGLINDMVRFNVLQYVVPEVKDLYNWLEVEFNPLKLCERVTKVLNWIREQPEKEP
ELQQYVPQLQNNTILRLLQQVAQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQV
RIDHTSRTLSFGSDLNYATREDAPIGPHLQSMPSEQIRNQLTAMSSVLAKALEVIKPAHI
LQEKEEQHQLAVTAYLKNSRKEHQRILARRQTIEERKERLESLNIQREKEELEQREAELQ
KVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIEDLE
ELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDYFERAKRLEEIPLIKSAYEEQRIKDM
DLWEQQEEERITTMQLEREKALEHKNRMSRMLEDRDLFVTRLKAARQSVYEEKLKQFEER
LAEERHNRLEERKRQRKEERRITYYREKEEEEQRRAEEKMLKEREERERAERAKREEELR
EYQERVKKLEEVERKKRQRELEIEERERRREEERRLGDDPLSRKDSRWGDRDSEGTWRKV
PEIDSEWRRGPPEKEWRRGEGRDEERPQRRDEDRPRRSGDDEERESSLRPDDDRVPRRGM
DDDRGPRRGPDEDRFSRRGTDDDRPSWRNADDDRPPRRIGDEDRGVWRQADDDRPPRRGL
DEDRGSWRTADEDRGPRRGMDEDRGLRRGGADEERSSWRNADDDRPRRGMDDDRGPRRGL
DDDRGPWRNTDDDRFSRRSADDDRFSRRGADDDRGPWRNTDDDRISRRADDDRIPRRGDD
SRPGPWRPFVKPGGWREKEKAREESWGPPRESRPSEDREWDREKERDRDNQDRDENDRDP
ERERDRERERERDRERDGDREDRFRRPRDEAGWRRGPAEESSSWRDASRRDDRDRDDRRR
ERDERRDLRERRDDRDRRGPPLRPEREEVSSWRRADDRKDDRAEERDAPRRVPPAALSRD
RERDRDRDREGEKEKTSWRAEKDRESLRRTKNETDEDGWTTVRR
NT seq 4095 nt NT seq  +upstreamnt  +downstreamnt
atgccggcctatttccagaggccggaaaatgccctcaaacgcgccaacgaatttcttgaa
gttggcaaaaagcagcctgctttggacgttctttacgatgttatgaaaagtaagaaacat
agaacatggcaaaagatacacgagccaattatgttgaaatacttggaactttgtgtggat
cttcgcaagagccacttggctaaagaaggcttatatcagtataagaacatttgtcaacag
gtgaacatcaaatctctagaggatgttgttagggcatacttgaaattggcagaggagaaa
actgaagctgctaaagaagaatcccagcagatggtcttagacatagaagatctggataat
attcaaactcctgagagtgttctcctaagtgctgtaagtggtgaagacactcaggatcgt
actgacagattacttttaactccatgggttaaattcctgtgggaatcatacagacagtgt
ttggaccttcttcggaacaattctagagtagagcgtctctaccatgatattgcccaacaa
gctttcaaattctgcctccaatatacccgtaaggctgaattccgtaagctgtgtgacaat
ttgagaatgcacttgtctcagattcaacgccaccataaccaaagtacagcaatcaatctt
aataatccagagagccagtccatgcatttggaaaccaggcttgttcagttggacagtgct
atcagcatggaattgtggcaggaagcattcaaagctgtggaagatattcatgggctattc
tccttgtctaaaaaaccgcccaaacctcagttgatggcaaattattataacaaagtctca
actgtattttggaaatctggaaatgctctttttcatgcatctacactccatcgtctttac
catttatctagagaaatgagaaagaatcttacacaagaagagatgcaaagaatgtcnnnn
nnnnnnnnnnntctttccatccccattacccctgagcgtactgatattgctcgacttctg
gatatggacggcattatagttgaaaaacagcgtcgccttgcaacactgctaggcctgcaa
gccccaccaacgcgaattggccttattaacgatatggtcagattcaatgtgctacaatat
gttgtcccagaagtaaaagacctttacaattggctggaagtcgaatttaacccactaaaa
ctctgtgagagagtcacaaaggttttaaattggattagggagcaacctgaaaaggagcca
gagttacaacagtatgtcccacagctgcaaaacaacaccatactccggcttctccagcag
gtggcacaaatttatcagagcattgagttttctcgtttgacttctctggttccttttgtt
gatgctttccaactggaacgggccatagtagatgcagccaggcactgcgaccttcaggtt
cgtattgaccacacatctcggacccttagttttggatctgatttgaattatgctactcga
gaagatgctccaattggtcctcatctgcagagcatgccttcagaacagatcagaaatcag
ctgacagccatgtcctcagtacttgcaaaagcccttgaagtcattaagccagctcatata
ctgcaagagaaagaagaacagcatcagttggctgttactgcataccttaaaaattcacgg
aaagagcatcagcgtatcctggctcgccgtcagacaattgaggaaaggaaagagcggctt
gagagtctgaatattcaacgtgagaaagaagagctggagcagagggaagctgaactccag
aaagtacggaaggctgaagaagagaggctgcgacaggaggcaaaggagagagagaaggag
cgtatcttacaggaacatgaacaaatcaagaagaaaactgttcgtgagcgtttggagcag
atcaagaagacagaactgggtgccaaagcgttcaaagatattgacattgaagaccttgaa
gaattggatcccgatttcatcatggctaaacaggttgaacaactggagaaagaaaagaag
gaacttcaggaacgcttaaagaatcaagaaaaaaagattgactactttgaaagagctaaa
cgtttggaagaaatccctttgataaagagtgcttatgaagaacagagaattaaagacatg
gatctgtgggaacaacaagaagaagaaagaattactacaatgcagctagaacgggaaaag
gctcttgaacataagaaccgaatgtcacggatgcttgaagacagagatttatttgtaacg
cggctcaaggcagcacgacagtctgtttatgaggaaaaacttaaacagtttgaagagcga
ttagcagaagaaaggcataatcgtttggaagaacgtaaaagacaacgtaaagaagaacga
agaataacctactatagagaaaaggaagaagaagagcagaggagggcggaagaaaaaatg
ctaaaagagcgggaagagagagagcgtgctgaacgggcgaaacgtgaggaggagcttcga
gaatatcaggagcgggtaaagaaattagaagaggtggaaaggaaaaaacgtcaaagggag
ttggaaattgaagaaagggaacgtcgtagagaggaggagagaagacttggtgatgatcca
ctttctagaaaggactctcgttggggagatagagattcagaaggcacatggagaaaagta
cctgaaatagattctgagtggagaagaggcccaccagagaaggagtggagacgtggagaa
gggcgggatgaagagaggcctcaaagaagagatgaagatcgaccaaggcgttcgggggat
gatgaagagagagagtcctctcttagaccagacgatgatcgggttccccggcgtggcatg
gatgacgacagaggcccaagacgtggtcctgatgaagataggttctctcgccgagggaca
gacgatgaccggccttcttggcgtaatgcagatgacgacaggcctcccagacgaattggc
gatgaagacaggggtgtctggcgtcaggcggatgatgacagaccacctagacgaggactg
gatgaggacagaggaagctggcgaacagctgatgaggacagaggacctaggcgtgggatg
gatgaggaccggggtctgcgccgaggaggtgcggatgaggagaggtcatcctggcggaac
gctgatgacgatcgtcccaggcggggcatggatgacgaccggggtcccaggcgtgggttg
gatgacgatcgaggaccttggcggaataccgacgatgatagattttccaggcgcagtgca
gatgatgacagattttccaggcgcggtgcagatgatgacagggggccttggagaaacacg
gatgatgatcggatctcaagacgggctgatgatgatcggattcctagaaggggtgatgac
tcaagacctggtccctggagaccgtttgtcaaaccaggtggatggagagagaaagaaaaa
gccagagaagagagttggggtccacctcgagaatcgagaccatcagaagaccgtgaatgg
gatagggaaaaagagagagaccgagataatcaagatcgcgatgagaacgacagggacccg
gagagagaaagagacagagagagggagagggagagggacagagagagagatggggatcgc
gaggaccgcttcagacggccgagggatgaagctggctggagaagaggaccagctgaagaa
tcttcaagctggagagatgcaagtcgtcgtgacgatagggatcgggatgaccgccgtcgt
gagagagatgagcgccgtgatctaagagaaagacgagatgacagagaccgaagaggacct
cctctcagaccagagcgtgaggaagtaagttcttggagacgtgctgatgacaggaaagat
gaccgggccgaagagcgggatgcccctcgtcgtgttcctcctgcggctctttcaagagat
cgagagagagatcgagaccgagacagagaaggtgaaaaagagaagacctcgtggagagct
gagaaagatagggaatctcttcgtcgcactaaaaatgagactgatgaagatggatggacc
acagtacgacgttaa

DBGET integrated database retrieval system