KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004532
Entry
103004532         CDS       T03086                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04150  mTOR signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04270  Vascular smooth muscle contraction
bacu04310  Wnt signaling pathway
bacu04360  Axon guidance
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04613  Neutrophil extracellular trap formation
bacu04650  Natural killer cell mediated cytotoxicity
bacu04664  Fc epsilon RI signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04926  Relaxin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu05017  Spinocerebellar ataxia
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103004532 (PRKCA)
   04012 ErbB signaling pathway
    103004532 (PRKCA)
   04014 Ras signaling pathway
    103004532 (PRKCA)
   04015 Rap1 signaling pathway
    103004532 (PRKCA)
   04310 Wnt signaling pathway
    103004532 (PRKCA)
   04370 VEGF signaling pathway
    103004532 (PRKCA)
   04066 HIF-1 signaling pathway
    103004532 (PRKCA)
   04020 Calcium signaling pathway
    103004532 (PRKCA)
   04070 Phosphatidylinositol signaling system
    103004532 (PRKCA)
   04072 Phospholipase D signaling pathway
    103004532 (PRKCA)
   04071 Sphingolipid signaling pathway
    103004532 (PRKCA)
   04151 PI3K-Akt signaling pathway
    103004532 (PRKCA)
   04150 mTOR signaling pathway
    103004532 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103004532 (PRKCA)
   04540 Gap junction
    103004532 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103004532 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    103004532 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    103004532 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    103004532 (PRKCA)
   04670 Leukocyte transendothelial migration
    103004532 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    103004532 (PRKCA)
   04929 GnRH secretion
    103004532 (PRKCA)
   04912 GnRH signaling pathway
    103004532 (PRKCA)
   04921 Oxytocin signaling pathway
    103004532 (PRKCA)
   04926 Relaxin signaling pathway
    103004532 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    103004532 (PRKCA)
   04918 Thyroid hormone synthesis
    103004532 (PRKCA)
   04919 Thyroid hormone signaling pathway
    103004532 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    103004532 (PRKCA)
   04916 Melanogenesis
    103004532 (PRKCA)
   04925 Aldosterone synthesis and secretion
    103004532 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103004532 (PRKCA)
   04270 Vascular smooth muscle contraction
    103004532 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    103004532 (PRKCA)
   04971 Gastric acid secretion
    103004532 (PRKCA)
   04972 Pancreatic secretion
    103004532 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103004532 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103004532 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    103004532 (PRKCA)
   04727 GABAergic synapse
    103004532 (PRKCA)
   04725 Cholinergic synapse
    103004532 (PRKCA)
   04728 Dopaminergic synapse
    103004532 (PRKCA)
   04726 Serotonergic synapse
    103004532 (PRKCA)
   04720 Long-term potentiation
    103004532 (PRKCA)
   04730 Long-term depression
    103004532 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    103004532 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103004532 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    103004532 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103004532 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004532 (PRKCA)
   05206 MicroRNAs in cancer
    103004532 (PRKCA)
   05205 Proteoglycans in cancer
    103004532 (PRKCA)
   05231 Choline metabolism in cancer
    103004532 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103004532 (PRKCA)
   05214 Glioma
    103004532 (PRKCA)
   05223 Non-small cell lung cancer
    103004532 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103004532 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    103004532 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    103004532 (PRKCA)
   05032 Morphine addiction
    103004532 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103004532 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103004532 (PRKCA)
   05161 Hepatitis B
    103004532 (PRKCA)
   05171 Coronavirus disease - COVID-19
    103004532 (PRKCA)
   05164 Influenza A
    103004532 (PRKCA)
   05163 Human cytomegalovirus infection
    103004532 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103004532 (PRKCA)
   05143 African trypanosomiasis
    103004532 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103004532 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103004532 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103004532 (PRKCA)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103004532 (PRKCA)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103004532 (PRKCA)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    103004532 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C2 C1_1 Pkinase_C APH Kinase-like
Other DBs
NCBI-GeneID: 103004532
NCBI-ProteinID: XP_007185612
UniProt: A0A384AE52
LinkDB
Position
Un
AA seq 559 aa
MKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTEEKLHVTVRDAKNLIPMDPN
GLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDR
TTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAK
LGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKI
LKKDVVIQDDDVECTMVEKRVLALMDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHI
QQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHM
MDGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQS
IMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHTFFRRIDWEKLENRE
IQPPFKPKVTFCTKMHWLQWASRPSCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDF
EGFSYVNPQFVHPTIQSTV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgaagtgtgacacctgtgatatgaacgtgcacaagcagtgcgtgataaacgtccccagc
ctctgcgggatggaccacacggagaagaggggccggatctacctgaaggccgaggtcacc
gaggaaaagctccacgtcacagtacgagatgcaaaaaatctcatccctatggatccaaat
gggctttcagatccttatgtgaagctgaagcttattcctgaccccaagaacgaaagcaaa
caaaaaaccaaaaccatccgttccacactgaacccccagtggaatgagtcctttacattc
aaattaaaaccttcagataaagaccgacgactgtccgtagagatctgggactgggatcga
accacccggaacgacttcatggggtccctttccttcggagtctcggagctgatgaagatg
ccggccagtggatggtacaagttgctgaaccaagaggaaggtgagtactacaatgtgccc
atcccagaaggtgatgaagaaggaaacatggagctcaggcagaaattcgagaaagccaag
ctcggccctgctggcaacaaagtcattagtccttctgaggacaggagacagccttccaac
aacctcgacagagtgaaactcaccgacttcaacttcctcatggtgctgggcaagggcagc
ttcgggaaggtgatgcttgcagacaggaaggggaccgaggagctgtacgccatcaagatc
ctgaagaaggacgtggtgatccaggatgacgacgtggagtgcaccatggtggagaagcgg
gtgctggccctgatggacaagcccccgttcctgacgcagctgcactcctgcttccagacg
gtggatcggctgtacttcgtcatggaatacgtcaatggcggggacctcatgtaccacatc
cagcaagtgggaaaatttaaggagccgcaagcagtgttctacgcagcagagatttccatc
gggttgttctttcttcataaaagagggatcatttatagagacctgaagttagataatgtc
atgctggattcggaaggacatatcaagattgcggacttcgggatgtgtaaggagcacatg
atggacggggtcacgaccaggaccttctgcgggaccccggattacatcgccccggagata
atcgcgtatcagccgtacgggagatccgtggactggtgggcctacggcgtcctgttgtac
gaaatgctggccgggcagcctccgtttgacggcgaggatgaggacgaactgtttcagtcc
atcatggagcacaacgtctcgtacccgaagtccttgtccaaggaggccgtttccatctgc
aaagggctgatgaccaaacaccccggcaagcggctgggctgcgggcccgagggagagcgg
gacgtgcgggaacacaccttcttccggaggatcgactgggagaagctggagaacagggag
atccagccgcccttcaagcccaaagtgactttctgcaccaaaatgcactggcttcagtgg
gcgtccaggccttcgtgcggcaaaggagcagagaactttgacaagttcttcacgcgaggg
cagcccgtcctaacgccgcccgaccagctggtcatcgccaacatcgaccagtctgatttt
gaagggttctcgtatgtcaacccccagttcgtgcaccccaccatacagagcacagtatga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103012542
Entry
103012542         CDS       T03086                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04062  Chemokine signaling pathway
bacu04064  NF-kappa B signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04150  mTOR signaling pathway
bacu04270  Vascular smooth muscle contraction
bacu04310  Wnt signaling pathway
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04613  Neutrophil extracellular trap formation
bacu04650  Natural killer cell mediated cytotoxicity
bacu04662  B cell receptor signaling pathway
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04912  GnRH signaling pathway
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04931  Insulin resistance
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu04973  Carbohydrate digestion and absorption
bacu05017  Spinocerebellar ataxia
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05140  Leishmaniasis
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05164  Influenza A
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103012542 (PRKCB)
   04012 ErbB signaling pathway
    103012542 (PRKCB)
   04014 Ras signaling pathway
    103012542 (PRKCB)
   04015 Rap1 signaling pathway
    103012542 (PRKCB)
   04310 Wnt signaling pathway
    103012542 (PRKCB)
   04370 VEGF signaling pathway
    103012542 (PRKCB)
   04064 NF-kappa B signaling pathway
    103012542 (PRKCB)
   04066 HIF-1 signaling pathway
    103012542 (PRKCB)
   04020 Calcium signaling pathway
    103012542 (PRKCB)
   04070 Phosphatidylinositol signaling system
    103012542 (PRKCB)
   04071 Sphingolipid signaling pathway
    103012542 (PRKCB)
   04150 mTOR signaling pathway
    103012542 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103012542 (PRKCB)
   04540 Gap junction
    103012542 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103012542 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    103012542 (PRKCB)
   04662 B cell receptor signaling pathway
    103012542 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    103012542 (PRKCB)
   04670 Leukocyte transendothelial migration
    103012542 (PRKCB)
   04062 Chemokine signaling pathway
    103012542 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    103012542 (PRKCB)
   04929 GnRH secretion
    103012542 (PRKCB)
   04912 GnRH signaling pathway
    103012542 (PRKCB)
   04921 Oxytocin signaling pathway
    103012542 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    103012542 (PRKCB)
   04918 Thyroid hormone synthesis
    103012542 (PRKCB)
   04919 Thyroid hormone signaling pathway
    103012542 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    103012542 (PRKCB)
   04916 Melanogenesis
    103012542 (PRKCB)
   04925 Aldosterone synthesis and secretion
    103012542 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103012542 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    103012542 (PRKCB)
   04971 Gastric acid secretion
    103012542 (PRKCB)
   04972 Pancreatic secretion
    103012542 (PRKCB)
   04973 Carbohydrate digestion and absorption
    103012542 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103012542 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103012542 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    103012542 (PRKCB)
   04727 GABAergic synapse
    103012542 (PRKCB)
   04725 Cholinergic synapse
    103012542 (PRKCB)
   04728 Dopaminergic synapse
    103012542 (PRKCB)
   04726 Serotonergic synapse
    103012542 (PRKCB)
   04720 Long-term potentiation
    103012542 (PRKCB)
   04730 Long-term depression
    103012542 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    103012542 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103012542 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103012542 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103012542 (PRKCB)
   05206 MicroRNAs in cancer
    103012542 (PRKCB)
   05205 Proteoglycans in cancer
    103012542 (PRKCB)
   05231 Choline metabolism in cancer
    103012542 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103012542 (PRKCB)
   05214 Glioma
    103012542 (PRKCB)
   05223 Non-small cell lung cancer
    103012542 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103012542 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    103012542 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    103012542 (PRKCB)
   05032 Morphine addiction
    103012542 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    103012542 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103012542 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103012542 (PRKCB)
   05161 Hepatitis B
    103012542 (PRKCB)
   05171 Coronavirus disease - COVID-19
    103012542 (PRKCB)
   05164 Influenza A
    103012542 (PRKCB)
   05163 Human cytomegalovirus infection
    103012542 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103012542 (PRKCB)
   05140 Leishmaniasis
    103012542 (PRKCB)
   05143 African trypanosomiasis
    103012542 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103012542 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103012542 (PRKCB)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103012542 (PRKCB)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103012542 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 103012542
NCBI-ProteinID: XP_007186372
UniProt: A0A384AGA0
LinkDB
Position
Un
AA seq 671 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKINQGTKAPEEKTTNTISKFDNNGNRDRMKLTDFHFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSXFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENVWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDASNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacggtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcaca
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgttttgtcgtgcacaagcggtgccatgag
tttgtcactttctcctgccccggcgctgacaagggtccagcctccgatgacccccgaagc
aaacacaagttcaagatccacacatactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtccac
aagcgctgcgtgatgaacgtccccagcctctgcggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaggtccttatcgttgtcgtaagagatgct
aaaaaccttgtacctatggaccctaatggcttgtcagatccttacgtgaaactgaaactg
attcctgatcccaagagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cctgagtggaacgagacatttagattccagctgaaagagtcggacaaagacagaagactg
tctgtagagatttgggattgggatctgaccagtaggaatgacttcatgggatctttgtca
tttgggatttctgaactgcagaaagctggtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaacgtacctgtgccaccggaaggcagtgagggcaacgaggaa
ctgcggcagaaatttgagagggccaagatcaatcaggggaccaaggctcctgaagaaaag
acgactaacaccatatccaaatttgacaacaacgggaacagggaccggatgaaactgact
gattttcacttcctgatggtgcttggaaaaggcagctttggcaaggtcatgctctccgag
cggaagggcacagatgagctctacgccgtgaagatcctgaagaaggacgtggtgatccaa
gatgatgacgtggaatgcacgatggtagagaagcgggtgctggccctgcccgggaagccg
cccttcctgacccagctgcattcctgattccagaccatggaccgcctgtactttgtgatg
gagtatgtgaatggtggcgacctcatgtaccacatccaacaagtgggccggttcaaggaa
cctcacgctgtattttatgctgcagaaattgccatcggtctgttcttcttacagagcaag
ggcatcatttaccgagacctgaaacttgacaatgtgatgctggattctgagggtcacatc
aagatcgctgatttcggcatgtgtaaggaaaacgtctgggacggagtgacaaccaagacc
ttctgtggcactccagactacatcgcccctgagataattgcttatcagccctatgggaag
tccgtggattggtgggcattcggagtcctgctgtatgagatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccagtctatcatggaacacaacgtggcttat
ccaaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgacgaaacacccg
ggcaaacgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcacgcgtttttc
cggtatattgactgggagaagcttgaacgcaaagagattcaacccccgtataagccgaaa
gccagagacaagcgagacgcctccaatttcgacaaagagttcaccagacagcctgtggaa
ctcacgcctactgataaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcctatactaacccagagtttgtcattaatgtgtag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103017540
Entry
103017540         CDS       T03086                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01521  EGFR tyrosine kinase inhibitor resistance
bacu04010  MAPK signaling pathway
bacu04012  ErbB signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04070  Phosphatidylinositol signaling system
bacu04071  Sphingolipid signaling pathway
bacu04150  mTOR signaling pathway
bacu04270  Vascular smooth muscle contraction
bacu04310  Wnt signaling pathway
bacu04370  VEGF signaling pathway
bacu04510  Focal adhesion
bacu04540  Gap junction
bacu04613  Neutrophil extracellular trap formation
bacu04650  Natural killer cell mediated cytotoxicity
bacu04666  Fc gamma R-mediated phagocytosis
bacu04670  Leukocyte transendothelial migration
bacu04713  Circadian entrainment
bacu04720  Long-term potentiation
bacu04723  Retrograde endocannabinoid signaling
bacu04724  Glutamatergic synapse
bacu04725  Cholinergic synapse
bacu04726  Serotonergic synapse
bacu04727  GABAergic synapse
bacu04728  Dopaminergic synapse
bacu04730  Long-term depression
bacu04750  Inflammatory mediator regulation of TRP channels
bacu04911  Insulin secretion
bacu04916  Melanogenesis
bacu04918  Thyroid hormone synthesis
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04925  Aldosterone synthesis and secretion
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04929  GnRH secretion
bacu04935  Growth hormone synthesis, secretion and action
bacu04960  Aldosterone-regulated sodium reabsorption
bacu04961  Endocrine and other factor-regulated calcium reabsorption
bacu04970  Salivary secretion
bacu04971  Gastric acid secretion
bacu04972  Pancreatic secretion
bacu05017  Spinocerebellar ataxia
bacu05022  Pathways of neurodegeneration - multiple diseases
bacu05031  Amphetamine addiction
bacu05032  Morphine addiction
bacu05143  African trypanosomiasis
bacu05146  Amoebiasis
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05170  Human immunodeficiency virus 1 infection
bacu05171  Coronavirus disease - COVID-19
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05214  Glioma
bacu05223  Non-small cell lung cancer
bacu05225  Hepatocellular carcinoma
bacu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103017540 (PRKCG)
   04012 ErbB signaling pathway
    103017540 (PRKCG)
   04014 Ras signaling pathway
    103017540 (PRKCG)
   04015 Rap1 signaling pathway
    103017540 (PRKCG)
   04310 Wnt signaling pathway
    103017540 (PRKCG)
   04370 VEGF signaling pathway
    103017540 (PRKCG)
   04066 HIF-1 signaling pathway
    103017540 (PRKCG)
   04020 Calcium signaling pathway
    103017540 (PRKCG)
   04070 Phosphatidylinositol signaling system
    103017540 (PRKCG)
   04071 Sphingolipid signaling pathway
    103017540 (PRKCG)
   04150 mTOR signaling pathway
    103017540 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103017540 (PRKCG)
   04540 Gap junction
    103017540 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    103017540 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    103017540 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    103017540 (PRKCG)
   04670 Leukocyte transendothelial migration
    103017540 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    103017540 (PRKCG)
   04929 GnRH secretion
    103017540 (PRKCG)
   04921 Oxytocin signaling pathway
    103017540 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    103017540 (PRKCG)
   04918 Thyroid hormone synthesis
    103017540 (PRKCG)
   04919 Thyroid hormone signaling pathway
    103017540 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    103017540 (PRKCG)
   04916 Melanogenesis
    103017540 (PRKCG)
   04925 Aldosterone synthesis and secretion
    103017540 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103017540 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    103017540 (PRKCG)
   04971 Gastric acid secretion
    103017540 (PRKCG)
   04972 Pancreatic secretion
    103017540 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103017540 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    103017540 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    103017540 (PRKCG)
   04727 GABAergic synapse
    103017540 (PRKCG)
   04725 Cholinergic synapse
    103017540 (PRKCG)
   04728 Dopaminergic synapse
    103017540 (PRKCG)
   04726 Serotonergic synapse
    103017540 (PRKCG)
   04720 Long-term potentiation
    103017540 (PRKCG)
   04730 Long-term depression
    103017540 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    103017540 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    103017540 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103017540 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103017540 (PRKCG)
   05206 MicroRNAs in cancer
    103017540 (PRKCG)
   05205 Proteoglycans in cancer
    103017540 (PRKCG)
   05231 Choline metabolism in cancer
    103017540 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103017540 (PRKCG)
   05214 Glioma
    103017540 (PRKCG)
   05223 Non-small cell lung cancer
    103017540 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    103017540 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    103017540 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    103017540 (PRKCG)
   05032 Morphine addiction
    103017540 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103017540 (PRKCG)
   05161 Hepatitis B
    103017540 (PRKCG)
   05171 Coronavirus disease - COVID-19
    103017540 (PRKCG)
   05163 Human cytomegalovirus infection
    103017540 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    103017540 (PRKCG)
   05143 African trypanosomiasis
    103017540 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103017540 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bacu01001]
    103017540 (PRKCG)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103017540 (PRKCG)
Protein kinases [BR:bacu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103017540 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like APH
Other DBs
NCBI-GeneID: 103017540
NCBI-ProteinID: XP_007181463
UniProt: A0A384A2A1
LinkDB
Position
Un
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRSKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTSDEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKVPVDGWYKLLNQEEGEYYNVPVADADNCGLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFTFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIVYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQAEFQGFTYVNPDFVHPDARSPISPAPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctttgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgct
cgcttcttcaagcagccaaccttctgcagccactgcactgacttcatatgggggattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacagacgatccccggagcaag
cacaagttccgtctgcacagctacagcagccccaccttctgcgaccactgtggctctctc
ctttacgggctggtgcaccagggcatgaagtgctcctgctgcgagatgaacgtgcaccgg
cgctgcgtgcgcagcgtgccctctctgtgcggtgtggaccacacggagcgccgcggccgc
ctgcagctggaaatccgggctcccacttcggatgagattcacgtcacggttggcgaggcc
cgtaacctcatcccaatggaccccaatggtctgtctgatccctatgtgaaactgaagctc
atcccagatcctcggaatttgacaaaacagaagacccggacggtgaaagccacgctaaac
cctgtgtggaacgagacctttgtgttcaacctgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcccgcaacgacttcatgggtgccatgtcc
tttggcgtctcggagctgctcaaggttcccgtggacggctggtacaagttactgaaccag
gaggagggcgaatattacaatgtgccagtggctgatgctgacaactgcggcctcctccag
aagtttgaggcctgtaactaccccttggaactgtacgagagggtgcggatgggtccttct
tcctctcccatcccctccccgtcccctagtcccaccgactccaagcgctgtttcttcggg
gcaagccctggacgtctgcacatctctgacttcaccttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggccgagcgcaggggctccgacgagctctatgccatcaag
atcctgaagaaagacgtgattgtccaggatgacgacgtggactgcaccctggtggagaaa
cgcgtgttggccctggggggtcgaggccccggaggccggccccactttctcacccagctt
cactccactttccagaccccggaccgcctgtattttgtgatggagtacgtcactgggggc
gacttgatgtaccacattcagcagttgggcaagtttaaggagccccatgcagcgttctac
gcagcggaaatcgccatcggcctcttcttccttcacaatcagggcatcgtctatcgggac
ctgaaactggacaacgtgatgctggatgccgaaggacacatcaagatcactgactttggc
atgtgcaaggagaacgtcttccccgggaccacaactcgcaccttctgtgggaccccggac
tacatagcccccgagatcattgcctaccagccctatgggaagtctgttgactggtggtcc
tttggggtcctgctgtatgagatgttggcggggcagcccccttttgatggggaggacgag
gaggaactgttccaggccatcatggaacaaactgtcacctaccccaagtcgctttcccgg
gaagctgtggccatctgcaaggggttcctaaccaagcacccagcaaagcgcctgggctcg
gggccagatggagaacccaccatccgagctcatggctttttccgctggatcgactgggaa
cggctggaaagattagagatcgcgcctcctttcagaccccgcccgtgtggccgcagcggc
gaaaacttcgacaagttcttcacgcgggcggcgccagcgttgactcccccagaccgccta
gttctggccagcatcgaccaagccgaattccaaggcttcacctatgtcaacccggatttc
gtgcacccggatgcccgcagccccatcagcccagcgcctgtgccagtcatgtaa

DBGET integrated database retrieval system