KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004554
Entry
103004554         CDS       T03086                                 

Gene name
FLT4
Definition
(RefSeq) fms related tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04010  MAPK signaling pathway
bacu04014  Ras signaling pathway
bacu04015  Rap1 signaling pathway
bacu04020  Calcium signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04510  Focal adhesion
bacu05200  Pathways in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103004554 (FLT4)
   04014 Ras signaling pathway
    103004554 (FLT4)
   04015 Rap1 signaling pathway
    103004554 (FLT4)
   04020 Calcium signaling pathway
    103004554 (FLT4)
   04151 PI3K-Akt signaling pathway
    103004554 (FLT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103004554 (FLT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004554 (FLT4)
  09162 Cancer: specific types
   05224 Breast cancer
    103004554 (FLT4)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103004554 (FLT4)
Protein kinases [BR:bacu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   103004554 (FLT4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C1-set
Other DBs
NCBI-GeneID: 103004554
NCBI-ProteinID: XP_007169890
UniProt: A0A383Z3Z8
LinkDB
Position
Un
AA seq 1368 aa
MQRRAALCLRLWLCLGLLDSERGLASGYSMTPPTLNITEETHVIDSSDSLSISCRGQHPL
EWAWPGAQDAPVTGEKDGEDMGIVRDCEGTDARPYCKVLLLQEAHANDTGSYRCYYKYIK
ARIEGTTAASTYVFVRDLEQPFINKPDTLLVNRKDSMWVPCLVSIPGLNVTLRSQSSALW
PDGQEVVWDDRRGMRVPTPLLRDALYLQCETTWGGQAFLSNPFLVHITGNELYDIQLFPK
KSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTI
HNVSQHDLGPYVCLANNGIQQFQESTEVIVHEKPFISVDWLKGPVLEATAGDELVKLPVK
LAAYPPPEFQWYKDRKAVSGRHSPHVLVLKEVTEASAGIYTLALWNSAAGLRRNISLELV
VNVPPHIHEKEASSPSIYSRHSRQALTCTAYGVPPPLSIQWHWRPWTPCKTFTQRSLSQR
RQQRDQMPQCQDWREVTMQDAVNPIESLDTWTEFVEGKNKTVSKLVIQDANVSAMYKCVV
FNKVGQDERLIYFYVTTIPDGFSIESEPSEDPLEGQAVHLSCRADNYTYQHLRWYRLNLS
TLHDAHGNPLLLDCKNVHLFATPLAASLEEAAPGVRHATLSLTIPSVAPEHEGDYVCEVQ
DRRSHDKHCHKKYLSVQALEVPRLTQNLTDLLVNVSDSLEMRCPVAGAHMPSIVWYKDER
PLEEESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGNMEI
VILIGTGVIAVFFWVLLLLIFCNMRRPTHADIKTGYLSIIMDPGEVPLEEQCEYLSYDAS
QWEFPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSE
LKILIHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRTKRETFNPYAEKSPEQ
RRRFCSMVEGAKADRRRPGSSDRALLTRLLMGKGGAGRAPPVQEAEDLWLSPLTMEDLVC
YSFQVARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARL
PLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKEGTRMRA
PELATPAIRRIMLSCWAGDPKERPAFSDLVEILGDLLQGRGHQEEEDCVVSCGSQSSEEG
SFLQTSTTALHVMETDADMEDSPPSLHRHSLAARYYNCVSFPGCLARGTQTQGPFRMKTF
EEFPMTLTTYKASVDSQTDSGMVLASEEFERLESRHRQESGLSSCKGPGRNMDVTMAHPD
PPGRRQRPDPGAQGQVFYNSEYGELAGRPEESDGIPSAQVPFFTDSSY
NT seq 4107 nt   +upstreamnt  +downstreamnt
atgcagcggcgtgccgcgctgtgcctgcgcctgtggctctgcctcggactgctcgacagc
gagcgtggcctggcgagcggctactccatgacccccccaaccctgaacatcacggaggag
acacacgtcatcgactccagtgacagcctgtccatctcctgcagggggcagcaccccctg
gagtgggcctggccaggggctcaggatgcaccagtcacaggggagaaggacggcgaggac
atggggatcgtgcgagactgtgagggcacagatgcccggccctactgcaaggttctgctg
ctgcaggaggcccacgccaatgacacgggcagctaccgctgctactacaagtatatcaag
gctcgcattgagggcaccactgcagccagcacctacgtatttgtgagagacttggagcag
ccattcatcaacaagccggacacactcctggtcaacaggaaggactccatgtgggtgccc
tgcctggtgtccatccccggcctcaacgtcacgctgcgctcgcaaagctcagcactgtgg
cctgatgggcaggaggtagtgtgggacgaccgccggggcatgcgtgtgcccactcccctg
ctgcgtgatgccctgtacctgcagtgtgagaccacttggggcggccaggccttcctatcc
aaccccttcctcgtgcatatcacaggaaatgagctctatgacatccagctgttccccaag
aaatcactggagctgctggttggggaaaagctggtcctgaactgcactgtgtgggccgag
ttcaactcgggcgtcaccttcgactgggactatccaggaaagcaggcagagcggggtaag
tgggtgccagagcggcgctcccagcagactcacacagagctctccagcatcctcaccatc
cacaacgtcagccagcacgacttgggcccatatgtgtgcctggccaacaatggcatccag
caattccaggagagcactgaggtcattgtgcatgaaaagcccttcatcagcgtcgactgg
ctcaagggtcccgtcctggaggccacggcaggagacgagctggtgaaactgcccgtgaag
ctggcagcatacccgccaccggagttccaatggtacaaggacagaaaggcagtgtcaggg
cgccatagtccacacgttctggtgctcaaggaggtgacggaagccagtgcgggcatctac
accctcgccctgtggaactccgcggccggcctgaggcgcaacatcagcctggagctggtg
gtaaatgtgcctccccacatccacgagaaggaggcctcctcccccagcatctactcccgc
catagtcgccaggccctcacctgtacggcctatggggtgccccctcctctcagcatccag
tggcactggcggccgtggaccccctgcaagaccttcacccagcgcagcctcagccagcgg
cggcagcagcgagaccaaatgccacagtgccaggactggagggaggtgaccatgcaggac
gctgtgaaccccattgagagcctggacacctggactgagtttgtggagggcaaaaataag
acggtgagcaagctggtgatccaggacgccaatgtgtctgccatgtacaagtgcgtggtc
ttcaacaaagtgggccaggatgagcggctcatctacttctatgtgaccaccatccccgat
ggcttcagcatagaatcggagccatcagaagatcctctagagggacaggccgtgcacctg
agctgccgggccgacaactacacttatcagcatttgcgctggtaccgcctcaacctgtcc
acgttgcatgacgctcacgggaacccgctgctgctcgactgcaagaacgtgcaccttttc
gccacgccgctggccgccagcctggaggaggcagcgcccggggtgcgccacgccacgctc
agcctgaccatccccagcgtggcaccggaacacgaaggcgactacgtgtgcgaggtgcag
gaccggcgcagccacgacaagcactgccacaagaagtacctgtcagtgcaggccctggaa
gtcccgcggctcacgcagaacttgaccgacctcctggtgaatgtgagcgattccttggag
atgaggtgcccggtggccggggcgcacatgcccagcatcgtgtggtacaaagatgagagg
ccgctggaggaagagtccggaatcgacctggcggactcgaaccagaggctgagcatccag
cgcgtacgcgaggaggatgccgggcgctatctgtgcagtgtgtgcaacgccaagggctgc
gtcaactcctccgccagcgtggccgtggaaggctccgaggataaaggcaacatggagatc
gtgatccttattggcaccggggtcatcgccgtcttcttctgggtcctcctcctcctcatc
ttctgtaacatgaggaggccaacccatgcagacatcaagaccggctacttgtccatcatc
atggaccctggggaagttcctttggaggagcagtgtgaatacctgtcctatgatgccagt
cagtgggagttccccagggaacggctgcaccttgggagagtcctcggccatggggccttt
gggaaggtggtggaagcctcggcctttggcatcaacaagggcagcagctgtgacactgtg
gccgtgaaaatgctgaaagagggcgccacagccagcgagcaccgtgccctgatgtcagag
ctcaaaatcctaatccacattggtaaccacctcaacgtggtcaacctcctgggggcgtgc
accaagcccaacggccccctcatggtgatcgtggagttttgcaagtacggcaacctctcc
aacttcttgcgcaccaagcgggagaccttcaacccctacgcggagaagtcccccgagcag
cgaaggcgcttctgctccatggtagagggtgccaaggctgaccggaggaggccagggagc
agcgacagggccctcctcacaaggctcctgatgggcaagggcggggcaggacgagcccct
ccggtccaagaagctgaggacctgtggctgagcccactgaccatggaagaccttgtctgc
tacagcttccaggtggcccgagggatggagttcctggcctctcgcaagtgcatccacaga
gacctggctgctcggaacatcttgctgtcagaaagtgatgtggtgaagatctgtgacttc
ggcctggcccgggacatctacaaagaccctgactacgtgcgcaagggcagcgcccgactg
cctctgaagtggatggcccccgagagcatcttcgacaaggtgtacaccacacagagcgat
gtgtggtcctttggggtactgctctgggagatcttctccctgggggcctccccataccct
ggggtgcagatcaatgaggagttctgccaacggctgaaagaaggcacccggatgagggcc
ccagagctggccactcctgccatacgccgcatcatgctgagctgctgggccggagacccc
aaagagaggcctgcgttctcagatctggtggagatcctgggggacctgcttcagggcagg
ggccatcaggaagaggaggactgcgtggtttcctgtggctctcagagctcagaggagggc
agcttcttgcagacgtccaccacggccctgcatgtcatggagaccgacgctgacatggag
gacagcccaccgagcctgcaccggcacagcctggctgccagatattataattgtgtgtcc
tttccgggatgccttgccagggggactcagacccagggtcccttcaggatgaaaacgttc
gaagaatttcccatgaccctgacaacctacaaggcctcagtggatagccagacggacagt
gggatggtgctggcctccgaggaatttgagcggctggagagcaggcacagacaagaaagt
gggctcagcagctgtaaaggaccaggcaggaatatggacgtgaccatggcgcaccctgac
cccccagggaggcggcagaggccagacccaggggcccagggccaggtgttctacaacagc
gagtatggggagctggcagggcgaccagaggagagcgatggcatcccatctgcccaagtg
cccttcttcacagacagcagctactaa

DBGET integrated database retrieval system