KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004683Help
Entry
103004683         CDS       T03086                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase (alpha-glucosidase)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00052  Galactose metabolism
bacu00500  Starch and sucrose metabolism
bacu01100  Metabolic pathways
bacu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103004683 (MGAM)
   00500 Starch and sucrose metabolism
    103004683 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103004683 (MGAM)
Enzymes [BR:bacu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103004683 (MGAM)
    3.2.1.20  alpha-glucosidase
     103004683 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 103004683
NCBI-ProteinID: XP_007177076
LinkDB All DBs
Position
Un
AA seq 1829 aa AA seqDB search
MARKKLKKFTTLELMLSVLLLVVFIITIPLFVLSARDSLESEGPGMTVTPDPGKSTTPGS
AECPVVNELERINCIPDQSPTKATCDQRGCCWKPQGTISVPWCYYSKSHGYQVEGNLVNT
NAGFTAQLKRLPSPSLFGNDVDNVLLTAEYQTSNRFHFKVTDQNQDRYEVPHEHVKPFKG
NAASSLTYKVEISKQPFSIKVIRTSNNHVLFDSSIGPLLFADQFLQLSIRLPSANVYGLG
EHVHQQYRHDMNWKTWPIFARDTIPKGDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAM
EVSLQPTPAVTYRTTGGILDFYVFLGNTPEQVVQEYQELIGRPALPSYWALGFHLSRYDY
GTLGNMKEVMERNRAAQLPYDVQHADIDYMHERKDFTYDPVNFKGFPEFVKELHSNGQKL
VIIVDPAISNNSSPSNPYGPYDRGSDMKIWVNASDGVTPLIGEVWPGKTVFPDYTDPKCT
AWWANECELFHNQVEFDGIWIDMNEVSNFVDGSVSGCSTSNLNYPPFTPRILDGYLFCKS
LCMDAVQHWGKQYDVHNLYGYSMAIATAEAVKTVFPNKRSFILTRSTFAGSGKFAAHWLG
DNAATWNDLRWSIPGMLEFNLFGIPMVGSDICGFTLDAPEELCRRWMQLGAFYPFSRNHN
GQGYKAQDPASFGADSLLLNSSRHYLTIRYALLPYLYTLFYRAHSQGDTVARPLLHEFYE
DSNTWDVHQQFLWGPGLLITPVLAEGAERVTAYVPDAVWYDYETGGRVKWRKQKVEMELP
GDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDDNKEAKGELFWDDGETKDTAAN
KVYLFCEFSVTQNRLDVKILQSTYTDPNSLAFKEIKILGTQEPTSVTVKHNGVEIQVSPN
VTYDSNLQVALITEIDLVLGGIYTVEWDVKIRDAEKIDCYPDENGASAENCTARGCVWEV
SGSPGVPFCYFVNDLYSVSDVQYDLHGATAVLSLKSAPYAYSLPSVPVNSLRLNVTYHKD
NMLQFKIYDPNNNRYEVPVPLNIPRVPSSTSESRLYDVLIKKNPFGIEIRRKSTGTVIWD
SQLLGFTFNDMFIRISTRLPSQYLYGFGETEHTAFRRDLNWNTWGMFSRDQPPGYKKNSY
GVHPYYMALEEDGNAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVFLGPTPELVTQ
QYTELIGRPVMVPYWSLGFQLCRYGYKNDAEIGSLYDEMVAVQIPYDVQYADIDYLERQL
DFTLSPKFEGLPALIARMKADGMRVILILDPAISGNETKPYPPFTRGVEDDVFIKDPNDG
SIVWGKVWPDFPDIVINSSLDWESQVEQYRAYVAFPDFFRNSTITWWKRELREMYTNPRD
PEKSLKFDGLWIDMNEPASFVSGAVPPGCKDAYLNHPPYMPYLESRDRGLSSKTLCMESQ
QLLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDN
TAAWDQLKKSIIGMMEFSLFGISFTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHNSI
GARRQDPVSWDSTFVTISRSVLQTRYALLPYLYTLMHRANTEGSTVVRPLLHEFVSDQVT
WDVDSQFLLGPAFLVSPVLEPNARNVTAYFPRARWYDYYTGVDIQARGEWKSLPAPLDHI
NLHVRGGYILPWQEPAQNTHLSRQKFTGFKVALDDEGTAEGWLFWDDGQSIDTYGKGLYY
LAHFSVSQNTMHSHVIFNKYISDTNPLKLGYIEIWGVGSVSVSSVSISVSGVVITPTFSY
NSTTQVLNIDVTSRNLSLHNFTSLTWRAL
NT seq 5490 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagttgaaaaagttcactactttggagcttatgctcagtgttcttctg
cttgtggtgtttatcatcactattcctctcttcgtgctttcagccagagattctttggaa
tcagaaggtcctgggatgacagttactccagatcctgggaaaagtaccactcctggttct
gcggagtgcccagtggtaaatgaattggaacggataaactgcatccctgaccagtcacca
acaaaggccacatgtgaccagcgtgggtgctgctggaaacctcagggaaccataagtgtg
ccctggtgctactattctaagagtcatggctatcaagtggagggcaaccttgtgaacaca
aatgcaggattcacagcccagttgaaaaggttgccttctccatctctttttggaaatgat
gtcgacaatgtccttctcacagcggaataccagacgtctaaccgtttccactttaaggta
actgaccaaaaccaggacagatacgaagtgccccatgaacatgtgaaacccttcaaagga
aatgctgcttcttccttgacctataaagttgagatctccaaacagccatttagcatcaaa
gtgatcagaacgagcaacaatcatgttctgtttgactccagcatcgggcccctgctgttt
gctgatcagttcctgcagctctccatccgactgcctagtgctaacgtgtatggtctggga
gaacacgtgcaccagcagtaccggcacgatatgaattggaagacctggcccatatttgcc
agggacacaatcccaaaaggggatggaactaacttgtatggtgcacagacattcttccta
tgccttgaagatgctagtggattgtcctttggagtgtttctgatgaacagcaatgccatg
gaggtttccctccagcccaccccagctgtcacttaccgcaccactgggggcattctcgac
ttctacgtgttcttgggaaacactccagagcaagtggttcaagagtatcaagagctcatt
ggacggccagccctaccctcatactgggcacttgggtttcatctcagtcgttatgactat
ggaaccctgggtaacatgaaagaagtcatggagagaaaccgtgccgcacagctgccttac
gacgttcagcatgctgatattgattatatgcatgagaggaaggacttcacttatgatcca
gtaaattttaagggcttccctgagtttgttaaagagttacacagtaacggacaaaaattg
gtcatcattgtggatccagccatctccaacaactcttccccaagtaacccctatggcccg
tatgacaggggttcagatatgaagatatgggtgaatgcttcagatggagtgactccactc
attggggaggtctggcctggaaaaactgtgtttcctgattacaccgaccccaagtgtact
gcttggtgggcaaatgaatgtgagcttttccacaatcaagtagaatttgatggaatctgg
attgatatgaatgaagtctccaacttcgtggatggttcagtttcaggatgttccacaagc
aatctaaattatcccccattcactcccagaatcctggatgggtacctgttctgcaagagt
ctctgcatggatgcagtacagcactggggcaagcagtacgatgtccacaatctgtatggc
tactccatggcaattgccacagcagaagctgtcaagactgtgttccctaacaagagaagc
ttcattttaacccgttctacctttgcggggtctggcaagtttgcagcccactggttagga
gacaacgcagccacctggaatgaccttcggtggtccatccctggcatgctcgagttcaac
ctttttggtatcccaatggtgggttctgatatatgtggctttacattggatgctcccgaa
gagctctgcaggaggtggatgcagctgggagcattctatccattttccaggaatcacaat
ggccaaggctacaaggcccaggatcctgcctcctttggagctgactctctgctgttgaat
tcctccaggcactaccttaccatccgctatgctctattgccctatctctacaccctcttc
taccgtgctcacagccagggggacacggtggccaggccccttctacatgagttctacgag
gacagcaacacttgggatgtgcaccaacagtttttatgggggcccggcctcctcatcact
ccggttctggctgagggtgcagagagagtgacagcatatgtgcctgatgccgtctggtat
gactatgagactgggggccgagtgaaatggaggaagcaaaaagtggagatggaacttcct
ggagacaaaattggacttcaccttcgagggggctacatcttccccacacagcagccagcc
acaaccactgtggccagtcgaaggaaccctcttggtcttatcattgccctggatgacaac
aaagaagcaaaaggcgaacttttctgggatgatggggaaacgaaagatactgcggccaat
aaagtttacctcttttgcgagttctccgtcacccaaaaccgcttggatgtgaagattttg
caatcaacctacacagaccccaatagtttagcatttaaagagattaaaatccttgggacc
caggaacctaccagtgttacagtgaaacacaatggtgtcgaaattcaagtttctcctaat
gtcacttatgattctaacctccaggtggcccttatcacagaaattgatcttgtcctggga
ggaatatacacagtggagtgggatgtgaagataagggatgcagaaaaaatagactgttat
cctgatgagaacggtgcttctgcagaaaattgtactgcccggggctgtgtctgggaggta
tccggttctcctggagtccctttttgctattttgtcaatgatctgtactctgtcagcgac
gttcagtatgacttacacggggccacagctgtcctctccttaaagtctgctccgtatgcc
tactctttgccctccgtacccgtgaactccctccgtctgaatgtgacctaccataaggat
aacatgctgcagtttaagatttatgatcccaacaacaaccggtatgaagttccagtccct
ctcaacatacccagggttccatccagcacctctgagagtcgactctatgatgtcctcatt
aagaagaatccttttgggattgaaattcgccggaagagtacaggcactgtaatttgggac
tctcagctccttggcttcaccttcaacgacatgttcatccgcatctccacgcgcctcccc
tcccagtacctctatggctttggggaaactgagcacacagcctttcgaagagacttgaac
tggaacacgtggggaatgttttcccgagaccagcccccggggtacaagaagaattcctat
ggtgtccacccatactacatggcactggaggaggatggcaatgcccatggggtgctcctg
ctaaacagcaacgccatggatgtgacattccagcccttgcctgccttgacataccgtacc
acaggaggaattctggacttctatgtcttcttggggccaactccagagcttgtcactcag
cagtacactgagttgattggtcggccagtgatggttccttactggtccttggggtttcag
ctgtgtcgctatggatacaagaacgacgctgagattggtagcttgtatgatgagatggtg
gctgtccagatcccctatgacgtgcagtacgcggacatcgactacctggagcggcagctg
gacttcaccctcagccccaagtttgaggggcttccagctctgattgctcgaatgaaggcc
gacgggatgcgggtcatcctcattctggacccagccatttctggcaacgagacaaagccc
tatccccctttcacgcggggtgtggaggacgacgtcttcatcaaagatccgaatgatgga
agcattgtctggggaaaggtctggcctgattttcctgatattgttatcaacagttctcta
gactgggaaagtcaagtggagcaataccgagcttatgtggccttcccagactttttccgt
aattcaaccatcacatggtggaaaagggagttgagagaaatgtacaccaatccacgggat
ccagagaagagcttgaagtttgatggcctgtggattgatatgaatgaaccggcgagcttc
gtgagtggggcagtccctccaggctgcaaggatgcctatctgaaccaccctccctacatg
ccatatttggagtccagggacaggggcctgagcagcaagaccctgtgcatggagagccag
cagctcctgcctgatggctccccggtgcggcactacgacgtgcacagcctgtacggatgg
gctcagaccagacccacatacgaagctgtgcaggaggtgacggggcagcgagggatcgtc
atcactcgctccactttcccctcttctggccgctggggaggacactggctgggtgacaac
acggccgcgtgggaccagctgaagaaatctatcattggcatgatggagtttagcctcttt
ggcatatcctttacaggagcagatatttgtggattctttcaagatgctgaatatgaaatg
tgtgctcgctggatgcagctgggggccttttaccccttctcgaggaaccacaacagcatt
ggggccaggaggcaagaccctgtgtcctgggattctacctttgtgactatctccagaagt
gtcctgcagaccagatacgccctgttgccatatctgtacaccctgatgcacagggccaac
acggagggcagcactgtcgtgcggcctcttctccatgagtttgtgtcagaccaggtgacc
tgggatgtagacagtcagttccttctgggcccagccttcctggtcagccctgtcctggag
cctaatgccagaaatgtcactgcatatttccctagagcccgctggtatgattactacacg
ggtgtggacattcaagcccggggagagtggaagtccttgccagcgcctcttgaccatatt
aatcttcatgtccgtgggggctacatcctgccctggcaagagcctgcgcagaacacccac
ttaagccgtcagaaattcacaggcttcaaggttgccttggatgatgaggggactgctgaa
ggttggctcttctgggatgatgggcaaagcattgatacctatgggaaaggactctactac
ctggcccacttttctgtcagccagaatacgatgcacagtcatgtaattttcaacaaatac
atcagcgatacaaaccctttgaaactgggctacattgagatctggggagtgggcagtgtc
tccgtttccagtgtcagcatctctgtgagcggcgtggttataacacccaccttctcctac
aactctacaacacaggtgttaaacattgatgtgaccagcagaaacctcagcttacataat
ttcacttcattgacatggagagcactgtga

DBGET integrated database retrieval system