KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004858
Entry
103004858         CDS       T03086                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta
  KO
K08528  retinoic acid receptor beta
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103004858 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    103004858 (RARB)
   05222 Small cell lung cancer
    103004858 (RARB)
   05223 Non-small cell lung cancer
    103004858 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bacu03000]
    103004858 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:bacu03310]
    103004858 (RARB)
Transcription factors [BR:bacu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    103004858 (RARB)
Nuclear receptors [BR:bacu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   103004858 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 103004858
NCBI-ProteinID: XP_007173599
UniProt: A0A383ZFG2
LinkDB
Position
Un
AA seq 584 aa
MSTSSHACHVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPPHHGLRSHPPPSGCSTPSPAT
IETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
IYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKECSDSAGVGGRCSQAPRCCWSADHT
LSSKGHERTSSSEAQDDFLGPQALASGTGRDAGQSAKLPTWPAVDSADESPLRTGAPSSP
EQTQDGAASGALRSACEGRQARRPGWRVMLGQASADTDQAVQSPERVGPGPQHELPLRWP
VGSDAAAGRMAGPVHEVSSYEAGGGCVPTCWAGPRMGAVNSSADHRVRLDLGLWDKFSEL
ATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLT
LNRTQMHNAGFGPLTDLVFTFAGQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKL
QEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQ
EMLENSEGHEPLTPSSSGNTAEHSPSASPGSVENSGVGQSPLLQ
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgagcaccagtagccacgcatgtcacgtcccggcggtgaacgggcacatgactcactat
cccgccgcaccctacccattactcttcccaccggtcattggcggactttccctgcctccc
caccatggcctccgcagccatcctcctccgagtggatgtagcaccccatcacctgcaacg
attgaaacgcagagcaccagctccgaggaactggtcccgagccctccgtctccacttcct
ccccctcgagtgtacaagccctgcttcgtctgccaggacaagtcatcggggtatcactat
ggggtcagcgcctgcgaggggtgtaaggggtttttccgcagaagtattcagaagaacatg
atttacacttgtcaccgagataagaactgtgttattaataaagtcaccaggaatcgatgc
cagtactgtcgactccagaagtgctttgaagtgggaatgtccaaagaatgttctgattca
gcaggtgtgggcgggcgttgctcacaggctcccaggtgctgctggtctgcagaccacact
ctgagtagcaaaggccacgagcgtacttcgagtagcgaggcccaggacgattttctgggc
ccccaggccctggcgtcagggacagggagagacgctggccagtctgcgaagctgccgacc
tggcctgctgttgactcagcggacgagtcccccttgcgcacaggggcaccatccagccca
gagcagacacaggacggggcggcctcgggagccttgaggtcggcctgcgaggggaggcag
gcccggagacctgggtggcgggtgatgctgggacaggcttccgcagacacagatcaggcc
gtgcagagccccgagagggtgggcccagggccgcagcacgagctgcctctgcgctggccg
gtgggcagtgacgcagctgccgggaggatggcgggcccggtgcatgaagtctcctcgtac
gaggctggcggaggctgcgttcccacgtgctgggccgggccgcggatgggcgctgtgaat
tccagtgccgaccatcgagtccgactggacctgggcctctgggacaaattcagtgaactg
gctaccaagtgcattattaagatcgtggagtttgctaaacgtctgcccggcttcaccggc
ttgaccatcgcagaccaaatcaccctgctgaaggcggcctgtttggacatcctgattctg
agaatctgcaccaggtataccccagagcaagacaccatgacgttttcggacggcctgacc
ctgaatcgaacccagatgcacaacgccgggttcggccccctgaccgacctcgtgttcacc
ttcgccggccagcttctgcctctggagatggacgacacggagacaggccttctcagcgcc
atctgcttgatctgtggagaccgtcaggaccttgaggaaccaacaaaagtagataagcta
caagaaccattgctggaagcactaaaaatttatatcagaaagagacgacccagcaagcct
cacatgtttccaaagatcctcatgaaaatcacagatctccgcagcatcagtgctaaaggt
gcagaacgtgtaattaccttgaaaatggaaattcccggctcgatgccccctctcattcag
gaaatgctggagaattctgaaggacatgagcccttgaccccaagctcaagtgggaacaca
gcagagcacagtcccagcgcctcgcccggctccgtggagaacagcggtgtcggtcagtca
ccactgctgcaataa

DBGET integrated database retrieval system