KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103004888
Entry
103004888         CDS       T03086                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00562  Inositol phosphate metabolism
bacu01100  Metabolic pathways
bacu04022  cGMP-PKG signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04371  Apelin signaling pathway
bacu04611  Platelet activation
bacu04725  Cholinergic synapse
bacu04921  Oxytocin signaling pathway
bacu05132  Salmonella infection
bacu05145  Toxoplasmosis
bacu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103004888 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103004888 (PIK3CG)
   04072 Phospholipase D signaling pathway
    103004888 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    103004888 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    103004888 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103004888 (PIK3CG)
   04062 Chemokine signaling pathway
    103004888 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103004888 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103004888 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    103004888 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103004888 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103004888 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103004888 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103004888 (PIK3CG)
Enzymes [BR:bacu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103004888 (PIK3CG)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103004888 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 103004888
NCBI-ProteinID: XP_007180946
UniProt: A0A384A0T2
LinkDB
Position
Un
AA seq 1101 aa
MELESHEQHVVLREDNRRRRWRMKPRSAAASLSSMELIPIEFVLPTSQRNTKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAADFYHRLSPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKVLHRSPGQIHVVQRLAPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
VTPRMAEVAGRDPKLYAMHPWVTSKPLPEYLLKKITNNYIFIVIHRSTTSQTIKVSADDT
PGTILQSFFTKMAKKKSLMDIPESQNERDFVLRVCGRDEYLVGETPIKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNADLTVFVEANIQYGQQVLCQRRTSPKPFTEEVLWNVWLEFRXXX
XXXXXXXLNLQIYCGKAPALSSKASAEAPAPESRGKAQLLYYVNLLLIDHRFLLRHGEYV
LHMWQLSGKAEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEGD
RVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKDPKAYPKLFSSVKWGQQ
EIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLL
QLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYL
RGCGTAMLRDFTQQVQVIDMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLEILQNLNLPQ
SFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSKETIGIIFKHGDDLRQD
MLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGA
FKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNLF
HIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLALR
HHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEEAKKYFLDQIEVCRDKGWT
VQFNWFLHLVLGIKQGEKHSA
NT seq 3306 nt   +upstreamnt  +downstreamnt
atggagctggagagccatgaacagcacgtggtgctgagagaggacaatcgccgcaggcgc
tggaggatgaagccgcgcagcgcggcggccagcctgtcctccatggagctcatccccatt
gagtttgtgctgcccaccagccagcgcaacaccaagacccccgaaacggcgctgctgcac
gtggctggccacggcaacgtggagcagatgaaggcccaggtgtggctgcgcgcgctggag
accagcgtggcggccgacttctaccaccggctcagccccgaccacttcctcctgctctac
cagaagaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagaccctggac
tgcctgcgctactggaaagtgctgcaccggagccccgggcagatccacgtggtgcagagg
ctcgcgccctctgaggagacgctggccttccagcgccagctcacggccctcataggctac
gacgtcaccgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccgccgcctg
gtgaccccgcgcatggccgaggtggccggccgtgaccccaagctctacgccatgcacccc
tgggtgacgtccaagcccctccccgagtacctgctgaagaagatcaccaacaactacatc
ttcattgtcattcatcgcagcaccaccagccagaccatcaaggtctcggccgatgacacc
ccgggcaccatcctccagagcttctttaccaagatggccaagaagaagtccctgatggat
atccctgaaagccagaacgaacgggactttgtgctgcgcgtctgtggccgggatgagtac
ctggtgggtgagacgcccatcaaaaacttccagtgggtgaggcagtgcctcaagaacggg
gaagagattcacctggtgcttgacactccgccggacccagccctggacgaggtgaggaag
gaagagtggccgctggtggacgactgcacgggggtcaccggctaccatgagcagctgacc
atccacgggaaggaccacgagagcgtgttcaccgtgtccctgtgggactgtgaccgcaag
ttcagggtaaaaatcagaggcatcgatatccccgtcctgccccggaacgcggacctcacg
gtttttgtggaggcaaacatccagtatgggcagcaagtcctttgccaaaggagaaccagc
cccaaacctttcacggaggaggtgctctggaatgtgtggcttgagttcaggnnnnnnnnn
nnnnnnnnnnnnnnnnnnntgctgaacctccagatctactgcggcaaagctccagctctg
tccagtaaggcctctgcggaggctcccgctcccgagtccagaggcaaagctcagcttctg
tattacgtgaacctgctgctgatagaccaccggttcctcctgcgccacggggagtacgtg
ctccacatgtggcagctatccgggaaggcggaagaccaaggcagcttcaatgccgacaag
ctcacgtcggccaccaacccggacaaggagaactcaatgtccatctccatccttctggac
aattactgtcaccccatagccttgcctaagcatcggcccacccctgacccggaaggggac
cgggttcgagcagaaatgcccaatcagcttcggaagcagctagaggcgatcatagccact
gatccgcttaaccctctcacagccgaagacaaagagctgctctggcatttcagatatgaa
agtctgaaggatcccaaagcgtatcctaagctctttagctcagtgaaatggggacagcaa
gaaattgtggccaaaacatatcagctgttagccagaagggaggtctgggatcaaagtgct
ttggatgttggattaacaatgcaactcctggactgcaacttttcggatgaaaacgtaaga
gccattgcagttcagaaactggagagcttggaggacgatgacgtgctacattacctgctc
cagctggtccaggctgtgaaatttgaaccataccatgacagtgcccttgccagatttctg
ctgaagcgtggcttgagaaacaaacgaattggtcacttcttattttggttcttgagaagt
gagatcgcccagtccagacactatcagcagaggtttgcagtgatcctggaagcctatctg
aggggctgtggcacggccatgctacgcgacttcacccagcaagtccaagtaattgacatg
ctacaaaaggtcaccattgatattaaatcgctctctgctgaaaagtatgacgtcagctcc
caagttatttcccaacttaagcaaaagcttgaaatcctgcagaatttgaatctcccccaa
agcttcagagttccgtatgaccctggactgaaagcgggagcactggtgattgaaaaatgt
aaagtgatggcctccaagaaaaagcccctgtggcttgagtttaaatgtgccgaccctaca
gctctgtcaaaagaaacaattggaattatctttaaacacggcgacgatctgcgccaggac
atgctgattttacagattctacgaatcatggagtccatttgggagactgaatctttggat
ctgtgcctcctgccatatggttgcatttcaactggcgacaaaataggaatgatcgagatc
gtgaaagacgccacgacgatcgccaaaattcagcaaagcacagtgggcaacacgggcgcc
tttaaagatgaagtcctgaatcactggctcaaagaaaaatgccctattgaagaaaagttt
caggcagcggtggagagattcgtttattcctgtgctggctactgtgtggcaacctttgtc
cttggaataggtgacagacacaatgacaatattatgatctcagagacaggaaatctgttt
catattgactttgggcacattcttgggaattacaaaagtttcctgggcattaataaagag
agagtgccatttgtgctaactccagacttcctgtttgtgatggggacttctggaaagaag
acaagtctacacttccagaaatttcaggatgtctgcgtcaaggcttacctagcccttcgt
catcacacaaaccttctcatcatcctcttctccatgatgttgatgacaggaatgccccag
ttaaccagcaaagaagacatcgaatacattcgggatgccctgacagtggggaagagcgag
gaggaggctaaaaagtattttctggatcagattgaagtttgcagagacaaaggatggact
gtgcagtttaactggttcctacatcttgttctcggcatcaaacaaggggagaaacattct
gcctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103014949
Entry
103014949         CDS       T03086                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04371  Apelin signaling pathway
bacu04611  Platelet activation
bacu04725  Cholinergic synapse
bacu04921  Oxytocin signaling pathway
bacu05145  Toxoplasmosis
bacu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103014949 (PIK3R5)
   04072 Phospholipase D signaling pathway
    103014949 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    103014949 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    103014949 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103014949 (PIK3R5)
   04062 Chemokine signaling pathway
    103014949 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103014949 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103014949 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    103014949 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103014949 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103014949 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103014949 (PIK3R5)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103014949 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 103014949
NCBI-ProteinID: XP_007166399
UniProt: A0A383YUN0
LinkDB
Position
Un
AA seq 882 aa
MQPGATTCTEDRIQHALERCLHGLSLSRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTHEVQEKGTYDLLAPLALLFSSTVLCTPHFPPDSDLLLKAAKTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLSTRSHRSSTVTVLLLNPVEVQAEFLTVAD
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDLPGLHCQLQSKTLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTKLQAVGEKAGFLGALDTAKPGKLRTIPIPVARCYTYSWNQDSFDI
LQEILLKEQELLQPGILGDDEEDGEDEEDEEDLETEGPCAERDSLLSGGSAAFHDSTLSL
ASSQASGPTLSRQLLTSFVAGLSDGMDSGYVEDGEESSFEWPKRPGSQERRGHRRPGQKF
NRIYKLFKSTSQLVLRRDSRTLEGSPDSARARPLRRPASLCSPCSPLDGPALPPSRAQRS
RSLPQHKLDPELPGWLLAPASRHRRRCPFLSGDEDPKASTLRVVVFGSDRISGKVARAYS
KLRRLESNRPLLTRFFKLQFFYVPMKRSRGTSASPAPRSQTPPLPTDPPRHPGPAELGAA
PWEESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSPAQLPILADM
LLYYCRFAARPVLLQVYQTELTFITGEKTTEIFIHSLELGHSAATRAIKASGPGSKRLGI
DGDREAIPLTLQIIYSKGAISGRSRWSNMEKVCTSVNLSKACRQQEDLDSSTEALTLNLT
EVVKRQNPKSKKGFNQISISQIKVDKVQIIGSNSCPFAVCLDQDERKILQSVVRCEVSPC
YKPEKSSLCPPPQRPSYLQAQAAPDLCSLLCLPIMTFSGALP
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacgacgtgcacggaggaccgcatccagcacgccctggagcgctgc
ttgcacgggctcagcctcagccgccgctccacctcctggtcagctgggctgtgtctcaac
tgctggagcctgcaggagctggtgagcagggatccaggccacttccttatcctcctggag
cagatcctgcagaaaacccacgaggtccaagagaagggcacctatgacctcctcgccccc
ctggccctgctcttctcctccactgtcctctgtactccacacttcccaccagactcagat
ctccttctgaaagcagccaaaacctaccaccgattcctgacctggcccgttccttactgc
agcatctgccaggaactgctcaccttcatcgatgctgaactgaaggccccaggaatctcc
taccagcgactggtgagggccgagcagggcctgtccactaggagtcatcgcagctccact
gtcaccgtactgttgctgaacccggtggaggtgcaggccgagttcctcaccgtggccgac
aagctgagcacgcctgggcactccccgcacagcgcctacaccaccctcctcctgcacgcc
ttccaggccacctttggggcccactgcgacctcccaggtctgcactgccagctgcagtcc
aagaccctggcagagctcgaggacatcttcacggagacggcagaagcacaggaactggca
tctggcatcggggatgcagctgaggcccggcagtggctcaggaccaagctgcaggcggtg
ggagagaaagccggcttccttggtgccttagacactgcaaagcctggcaagctccgtacc
atccccatccctgtcgccaggtgctacacctacagctggaaccaggacagctttgacatc
ctgcaggaaatcctgctcaaggaacaggagctgctccagccaggaatcctgggggacgat
gaggaggacggggaggacgaggaggacgaggaggacttggaaaccgaggggccttgtgcc
gagagggactcgctgctctccggcggctcggcagccttccacgactccacgctgtcgctt
gcctcatcccaggcctcgggacccaccctctcccgccagttgctgacctcctttgtcgcg
ggcctctctgacggcatggatagtggctacgtggaggacggcgaggagagctccttcgag
tggcccaagaggcctggcagccaggagcgccggggccaccgcaggcccgggcagaagttc
aacaggatctataagctcttcaagagcaccagccagctggtgctgcggagggactcccgg
accctggagggcagcccggacagcgcccgcgcccgccccctgcgccggcccgccagcctc
tgcagcccctgcagccccctggatggcccggcgctgcccccgtcccgggcccagcgctcc
cgctccctgccccagcacaagctcgaccccgagctgcccggctggctcctggcccccgcc
tcccgtcaccggcgccgctgccccttcctgagcggggacgaggaccccaaggcctccacg
ctgcgagtcgtggtcttcggctccgatcggatctcggggaaggtggcccgggcgtacagc
aaactgcggcggctggagagcaaccgtccgctcctcacgcggttcttcaagcttcagttc
ttctatgtgcccatgaagcggagccgcgggaccagcgccagcccagcccctcggagccag
acgccgccgctccccacagaccccccgaggcaccccggccctgcggagctgggtgcagcc
ccctgggaggaaagcaccaatgacatctcccactacctcggcatgcttgacccctggtat
gagcgcaacgtcctgggcctcatgcacctgccccctgaagtcctgtgccagcagtctctg
aaggctgagtcccggcccctggagggctctcctgcccagctgcccatcctggcggacatg
ctgctctattactgccgcttcgctgcccggccggtgctgctgcaggtctaccagaccgag
ctgaccttcatcaccggggagaagacaacagagatcttcatccactccctggagctgggt
cactccgccgccacacgcgccatcaaggcttcgggtcctggcagcaagcgactgggcatc
gatggtgaccgggaggccatccctctaacactacagattatttacagcaagggggccatc
agtggacgcagtcgctggagtaacatggagaaggtctgcacctccgtcaacctcagcaag
gcctgccggcagcaggaggacctagactccagcacggaggccctgacgctaaacctgaca
gaagtggtgaaaaggcagaaccctaaatccaagaagggcttcaaccagattagcatctcg
cagatcaaagtggacaaggtgcagattatcggctctaacagctgcccctttgccgtgtgc
ctggaccaggacgagaggaagatcctgcagagtgtggtcaggtgtgaggtctcaccctgc
tacaagccggagaagagcagcctctgccccccaccccagaggccctcctacctgcaggcg
caggccgcacccgacctctgctccctgctctgtctgcccatcatgactttcagtggcgct
ctgccctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015229
Entry
103015229         CDS       T03086                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04022  cGMP-PKG signaling pathway
bacu04062  Chemokine signaling pathway
bacu04072  Phospholipase D signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04261  Adrenergic signaling in cardiomyocytes
bacu04371  Apelin signaling pathway
bacu04611  Platelet activation
bacu04725  Cholinergic synapse
bacu04921  Oxytocin signaling pathway
bacu05145  Toxoplasmosis
bacu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103015229 (PIK3R6)
   04072 Phospholipase D signaling pathway
    103015229 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    103015229 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    103015229 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103015229 (PIK3R6)
   04062 Chemokine signaling pathway
    103015229 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103015229 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103015229 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    103015229 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    103015229 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103015229 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bacu04131]
    103015229 (PIK3R6)
Membrane trafficking [BR:bacu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103015229 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 103015229
NCBI-ProteinID: XP_007166400
UniProt: A0A383YU52
LinkDB
Position
Un
AA seq 754 aa
MESSDVDLDLQRSVHAVLRELSAQAPALPSNQGMWRWSLHKKVERDPGKSPALVRILLRE
LEKAESEDARHVIIPLLHTLMYVLTKATGITEELHRRTYAFCTRLLTLPAPYCTVALECA
MRLKTETAVPGTLYQRLVIAEQNLTSELYPFRERVFLFVDPELVSPSVCSALLLEIEAAQ
GQQTPEACMRHVVSHALQAALGEACEAGVLQRKLQTSSRRALERYFHAVVAAVEQMASEP
SPSREGHLERLEEIYCSLLGPAEAARGRCGGDRPQARLPSIPLPSPHITFHLWTDEEQLW
EELVLFLRLRSQLRLSADLEALDLQGFLPDRELARASVLSTDSGIERDLPWGADEPPTPG
SPEVERAGLQRKGGIKKRVWPPDILMPSSWDGPPGLHRRIGRPSGDRELLPGVSRLHTAH
VLVLGDDRMLGRLARAYHSLRKRETQKFCLTPRLSLQLYYIPVLAPEKPTASRHSELGEL
AAFLGRADPWYESLVNTLCPAIRKLAELPLSLDTSQTVDPFILDAITYYVRMGTQPIYFQ
IYAVKIFFSDLSQDPAEDIFLTELKVKIQDSKFPRDSLSPRRRGVAEGPGAELSICYQKA
LLSHRTREVTVSLRAAGLVLEALPASDTEGPTHCPPTAAPDIDHTCLNISVTEVVKTSNL
AGRSFSTVTNTFRTADIQIQSQDQRLLTLLLDKDSCRMYRDVARFEVAPCPEPCSGAQKS
KVLGLSSHQEEMERTKAKAKPLLMPINTFSGIVQ
NT seq 2265 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggatctggacctccagcggagcgtgcatgctgttctccgagag
ctcagcgcccaggcccctgccctgccgagcaaccaaggcatgtggagatggtccctgcac
aagaaggtcgagcgggatcctggcaagagtccggcactggtccgcatcctgctcagagaa
ctggagaaggcagaaagtgaggacgcccggcatgtcatcattcccttgctgcacactcta
atgtacgtgctcactaaggccacgggcatcacagaggagctccaccggaggacctatgcc
ttttgcacgaggttgctgaccctgcccgccccctactgcaccgtcgccctggagtgcgcc
atgaggctgaaaacggagacggccgtcccagggacgctgtaccagaggctggtcattgcc
gagcagaacctgacgagcgagctgtaccccttccgggagagagtgttcctcttcgtggat
cctgagctggtgtctccctccgtgtgcagcgccctgctgctggagatcgaggcggcccag
gggcagcagacaccagaggcctgcatgcgccacgtggtctcccacgccctgcaggcggcg
ctgggggaggcctgcgaggcaggagtgctgcaaaggaagctgcagaccagctcccgccgc
gccctggagcgctatttccacgccgtggtggcagccgtggagcagatggccagcgagccc
agcccgagccgggagggccacctggagaggctggaggagatttactgctcgctgctgggg
ccggcggaggccgccagggggcgctgcggcggtgaccgcccccaggcccggctgccaagc
atccctctgcccagcccccatatcaccttccacctatggaccgatgaggagcagctctgg
gaggaactggtgctcttcctgcgcctgcgatcccagctccgcctcagtgcagacttggaa
gccttggatctgcagggcttcctgccagaccgggagttggcccgggcgtccgtgctgtcc
accgacagcggcatcgagcgggaccttccttggggggccgacgagccgcccacacccggc
agccccgaggtggagcgagccgggctgcagcgcaaagggggcatcaagaagcgggtgtgg
cccccggacatcctgatgcccagcagctgggatgggcccccggggctgcaccggaggatt
ggcaggcccagcggggatagggagctgctgcctggggtctcccggctccacacggcccac
gtgctggtgctgggggatgaccggatgctggggcgcctggcccgggcctaccacagcctc
aggaaacgagagacccagaagttctgcctcactcccagactcagcctgcagctctactac
atccctgtgctggcacctgagaagcccacagcatccaggcattcggagctcggagagttg
gctgcgttcctgggccgcgcagacccgtggtacgagagcctcgtcaacaccctgtgcccc
gccatccgcaagctggcagagctgcctctctccctggacacatcccagaccgtagacccc
ttcatcctggatgccatcacctactatgttcgcatgggcacccaacccatctatttccag
atctacgcagtcaagatcttcttcagtgacctgagccaagaccctgcagaggacatcttc
ctcacagagctcaaagtcaagatccaagactccaagttccccagagatagtctttcaccc
aggaggaggggcgtggccgagggcccaggggctgagctctccatctgctaccagaaggcc
ctgctcagccaccgcacccgagaggtcaccgtctccctgcgggccgctgggctggtcctg
gaggcccttccagccagtgacactgaagggcccacccactgccccccaactgctgctccc
gatatagaccacacatgcctgaatattagcgtgacagaggttgtcaagacctccaacttg
gcaggaaggtccttctctacggtgacaaacaccttccggacggctgacatccagatccaa
agccaggaccagaggctgctgacactgttgctggacaaggacagttgccgcatgtacagg
gacgtggccaggttcgaggttgctccctgcccagagccgtgttctggggcccagaaatcc
aaggtgctggggctcagctcacaccaggaggagatggaaagaaccaaagccaaggccaag
ccccttctaatgcccatcaacacgttctctggcatcgtccagtga

DBGET integrated database retrieval system