Balaenoptera acutorostrata scammoni (minke whale): 103004931 Help Entry 103004931         CDS       T03086                                  Gene name NRAS Definition (RefSeq) neuroblastoma RAS viral oncogene homolog   KO K07828   GTPase NRas Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu01521   EGFR tyrosine kinase inhibitor resistance bacu01522   Endocrine resistance bacu04010   MAPK signaling pathway bacu04012   ErbB signaling pathway bacu04014   Ras signaling pathway bacu04015   Rap1 signaling pathway bacu04062   Chemokine signaling pathway bacu04068   FoxO signaling pathway bacu04071   Sphingolipid signaling pathway bacu04072   Phospholipase D signaling pathway bacu04137   Mitophagy - animal bacu04140   Autophagy - animal bacu04150   mTOR signaling pathway bacu04151   PI3K-Akt signaling pathway bacu04210   Apoptosis bacu04211   Longevity regulating pathway bacu04213   Longevity regulating pathway - multiple species bacu04218   Cellular senescence bacu04360   Axon guidance bacu04370   VEGF signaling pathway bacu04371   Apelin signaling pathway bacu04540   Gap junction bacu04550   Signaling pathways regulating pluripotency of stem cells bacu04625   C-type lectin receptor signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu04660   T cell receptor signaling pathway bacu04662   B cell receptor signaling pathway bacu04664   Fc epsilon RI signaling pathway bacu04714   Thermogenesis bacu04720   Long-term potentiation bacu04722   Neurotrophin signaling pathway bacu04725   Cholinergic synapse bacu04726   Serotonergic synapse bacu04730   Long-term depression bacu04810   Regulation of actin cytoskeleton bacu04910   Insulin signaling pathway bacu04912   GnRH signaling pathway bacu04915   Estrogen signaling pathway bacu04916   Melanogenesis bacu04917   Prolactin signaling pathway bacu04919   Thyroid hormone signaling pathway bacu04921   Oxytocin signaling pathway bacu04926   Relaxin signaling pathway bacu04929   GnRH secretion bacu04933   AGE-RAGE signaling pathway in diabetic complications bacu04935   Growth hormone synthesis, secretion and action bacu05010   Alzheimer disease bacu05022   Pathways of neurodegeneration - multiple diseases bacu05034   Alcoholism bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05163   Human cytomegalovirus infection bacu05165   Human papillomavirus infection bacu05166   Human T-cell leukemia virus 1 infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05170   Human immunodeficiency virus 1 infection bacu05200   Pathways in cancer bacu05203   Viral carcinogenesis bacu05205   Proteoglycans in cancer bacu05206   MicroRNAs in cancer bacu05210   Colorectal cancer bacu05211   Renal cell carcinoma bacu05213   Endometrial cancer bacu05214   Glioma bacu05215   Prostate cancer bacu05216   Thyroid cancer bacu05218   Melanoma bacu05219   Bladder cancer bacu05220   Chronic myeloid leukemia bacu05221   Acute myeloid leukemia bacu05223   Non-small cell lung cancer bacu05224   Breast cancer bacu05225   Hepatocellular carcinoma bacu05226   Gastric cancer bacu05230   Central carbon metabolism in cancer bacu05231   Choline metabolism in cancer bacu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103004931 (NRAS)    04012 ErbB signaling pathway     103004931 (NRAS)    04014 Ras signaling pathway     103004931 (NRAS)    04015 Rap1 signaling pathway     103004931 (NRAS)    04370 VEGF signaling pathway     103004931 (NRAS)    04371 Apelin signaling pathway     103004931 (NRAS)    04068 FoxO signaling pathway     103004931 (NRAS)    04072 Phospholipase D signaling pathway     103004931 (NRAS)    04071 Sphingolipid signaling pathway     103004931 (NRAS)    04151 PI3K-Akt signaling pathway     103004931 (NRAS)    04150 mTOR signaling pathway     103004931 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103004931 (NRAS)    04137 Mitophagy - animal     103004931 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103004931 (NRAS)    04218 Cellular senescence     103004931 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103004931 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103004931 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103004931 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103004931 (NRAS)    04650 Natural killer cell mediated cytotoxicity     103004931 (NRAS)    04660 T cell receptor signaling pathway     103004931 (NRAS)    04662 B cell receptor signaling pathway     103004931 (NRAS)    04664 Fc epsilon RI signaling pathway     103004931 (NRAS)    04062 Chemokine signaling pathway     103004931 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103004931 (NRAS)    04929 GnRH secretion     103004931 (NRAS)    04912 GnRH signaling pathway     103004931 (NRAS)    04915 Estrogen signaling pathway     103004931 (NRAS)    04917 Prolactin signaling pathway     103004931 (NRAS)    04921 Oxytocin signaling pathway     103004931 (NRAS)    04926 Relaxin signaling pathway     103004931 (NRAS)    04935 Growth hormone synthesis, secretion and action     103004931 (NRAS)    04919 Thyroid hormone signaling pathway     103004931 (NRAS)    04916 Melanogenesis     103004931 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     103004931 (NRAS)    04726 Serotonergic synapse     103004931 (NRAS)    04720 Long-term potentiation     103004931 (NRAS)    04730 Long-term depression     103004931 (NRAS)    04722 Neurotrophin signaling pathway     103004931 (NRAS)   09158 Development and regeneration    04360 Axon guidance     103004931 (NRAS)   09149 Aging    04211 Longevity regulating pathway     103004931 (NRAS)    04213 Longevity regulating pathway - multiple species     103004931 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     103004931 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103004931 (NRAS)    05206 MicroRNAs in cancer     103004931 (NRAS)    05205 Proteoglycans in cancer     103004931 (NRAS)    05203 Viral carcinogenesis     103004931 (NRAS)    05230 Central carbon metabolism in cancer     103004931 (NRAS)    05231 Choline metabolism in cancer     103004931 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103004931 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103004931 (NRAS)    05225 Hepatocellular carcinoma     103004931 (NRAS)    05226 Gastric cancer     103004931 (NRAS)    05214 Glioma     103004931 (NRAS)    05216 Thyroid cancer     103004931 (NRAS)    05221 Acute myeloid leukemia     103004931 (NRAS)    05220 Chronic myeloid leukemia     103004931 (NRAS)    05218 Melanoma     103004931 (NRAS)    05211 Renal cell carcinoma     103004931 (NRAS)    05219 Bladder cancer     103004931 (NRAS)    05215 Prostate cancer     103004931 (NRAS)    05213 Endometrial cancer     103004931 (NRAS)    05224 Breast cancer     103004931 (NRAS)    05223 Non-small cell lung cancer     103004931 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103004931 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     103004931 (NRAS)   09165 Substance dependence    05034 Alcoholism     103004931 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103004931 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103004931 (NRAS)    05170 Human immunodeficiency virus 1 infection     103004931 (NRAS)    05161 Hepatitis B     103004931 (NRAS)    05160 Hepatitis C     103004931 (NRAS)    05163 Human cytomegalovirus infection     103004931 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103004931 (NRAS)    05165 Human papillomavirus infection     103004931 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103004931 (NRAS)    01522 Endocrine resistance     103004931 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bacu04131]     103004931 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bacu04147]     103004931 (NRAS)    04031 GTP-binding proteins [BR:bacu04031]     103004931 (NRAS) Membrane trafficking [BR:bacu04131]  Endocytosis   Macropinocytosis    Ras GTPases     103004931 (NRAS) Exosome [BR:bacu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103004931 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103004931 (NRAS)   Exosomal proteins of breast cancer cells    103004931 (NRAS)   Exosomal proteins of colorectal cancer cells    103004931 (NRAS) GTP-binding proteins [BR:bacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103004931 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  103004931 NCBI-ProteinID:  XP_007169415 UniProt:  A0A383Z2W3 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca atccagctgatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctttgt gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggaacagatt aagcgtgtaaaagactcagatgatgtacctatggtgctagtaggaaacaagtgtgatttg ccaacaaggacagttgacacaaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgtatgggattgccatgtgtggtgatgtaa

Balaenoptera acutorostrata scammoni (minke whale): 103006545 Help Entry 103006545         CDS       T03086                                  Gene name HRAS Definition (RefSeq) HRas proto-oncogene, GTPase   KO K02833   GTPase HRas Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu01521   EGFR tyrosine kinase inhibitor resistance bacu01522   Endocrine resistance bacu04010   MAPK signaling pathway bacu04012   ErbB signaling pathway bacu04014   Ras signaling pathway bacu04015   Rap1 signaling pathway bacu04062   Chemokine signaling pathway bacu04068   FoxO signaling pathway bacu04071   Sphingolipid signaling pathway bacu04072   Phospholipase D signaling pathway bacu04137   Mitophagy - animal bacu04140   Autophagy - animal bacu04144   Endocytosis bacu04150   mTOR signaling pathway bacu04151   PI3K-Akt signaling pathway bacu04210   Apoptosis bacu04211   Longevity regulating pathway bacu04213   Longevity regulating pathway - multiple species bacu04218   Cellular senescence bacu04360   Axon guidance bacu04370   VEGF signaling pathway bacu04371   Apelin signaling pathway bacu04510   Focal adhesion bacu04540   Gap junction bacu04550   Signaling pathways regulating pluripotency of stem cells bacu04625   C-type lectin receptor signaling pathway bacu04630   JAK-STAT signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu04660   T cell receptor signaling pathway bacu04662   B cell receptor signaling pathway bacu04664   Fc epsilon RI signaling pathway bacu04714   Thermogenesis bacu04720   Long-term potentiation bacu04722   Neurotrophin signaling pathway bacu04725   Cholinergic synapse bacu04726   Serotonergic synapse bacu04730   Long-term depression bacu04810   Regulation of actin cytoskeleton bacu04910   Insulin signaling pathway bacu04912   GnRH signaling pathway bacu04915   Estrogen signaling pathway bacu04916   Melanogenesis bacu04917   Prolactin signaling pathway bacu04919   Thyroid hormone signaling pathway bacu04921   Oxytocin signaling pathway bacu04926   Relaxin signaling pathway bacu04929   GnRH secretion bacu04933   AGE-RAGE signaling pathway in diabetic complications bacu04935   Growth hormone synthesis, secretion and action bacu05010   Alzheimer disease bacu05022   Pathways of neurodegeneration - multiple diseases bacu05034   Alcoholism bacu05132   Salmonella infection bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05163   Human cytomegalovirus infection bacu05165   Human papillomavirus infection bacu05166   Human T-cell leukemia virus 1 infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05170   Human immunodeficiency virus 1 infection bacu05200   Pathways in cancer bacu05203   Viral carcinogenesis bacu05205   Proteoglycans in cancer bacu05206   MicroRNAs in cancer bacu05210   Colorectal cancer bacu05211   Renal cell carcinoma bacu05213   Endometrial cancer bacu05214   Glioma bacu05215   Prostate cancer bacu05216   Thyroid cancer bacu05218   Melanoma bacu05219   Bladder cancer bacu05220   Chronic myeloid leukemia bacu05221   Acute myeloid leukemia bacu05223   Non-small cell lung cancer bacu05224   Breast cancer bacu05225   Hepatocellular carcinoma bacu05226   Gastric cancer bacu05230   Central carbon metabolism in cancer bacu05231   Choline metabolism in cancer bacu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103006545 (HRAS)    04012 ErbB signaling pathway     103006545 (HRAS)    04014 Ras signaling pathway     103006545 (HRAS)    04015 Rap1 signaling pathway     103006545 (HRAS)    04370 VEGF signaling pathway     103006545 (HRAS)    04371 Apelin signaling pathway     103006545 (HRAS)    04630 JAK-STAT signaling pathway     103006545 (HRAS)    04068 FoxO signaling pathway     103006545 (HRAS)    04072 Phospholipase D signaling pathway     103006545 (HRAS)    04071 Sphingolipid signaling pathway     103006545 (HRAS)    04151 PI3K-Akt signaling pathway     103006545 (HRAS)    04150 mTOR signaling pathway     103006545 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103006545 (HRAS)    04140 Autophagy - animal     103006545 (HRAS)    04137 Mitophagy - animal     103006545 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103006545 (HRAS)    04218 Cellular senescence     103006545 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103006545 (HRAS)    04540 Gap junction     103006545 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103006545 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103006545 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103006545 (HRAS)    04650 Natural killer cell mediated cytotoxicity     103006545 (HRAS)    04660 T cell receptor signaling pathway     103006545 (HRAS)    04662 B cell receptor signaling pathway     103006545 (HRAS)    04664 Fc epsilon RI signaling pathway     103006545 (HRAS)    04062 Chemokine signaling pathway     103006545 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103006545 (HRAS)    04929 GnRH secretion     103006545 (HRAS)    04912 GnRH signaling pathway     103006545 (HRAS)    04915 Estrogen signaling pathway     103006545 (HRAS)    04917 Prolactin signaling pathway     103006545 (HRAS)    04921 Oxytocin signaling pathway     103006545 (HRAS)    04926 Relaxin signaling pathway     103006545 (HRAS)    04935 Growth hormone synthesis, secretion and action     103006545 (HRAS)    04919 Thyroid hormone signaling pathway     103006545 (HRAS)    04916 Melanogenesis     103006545 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     103006545 (HRAS)    04726 Serotonergic synapse     103006545 (HRAS)    04720 Long-term potentiation     103006545 (HRAS)    04730 Long-term depression     103006545 (HRAS)    04722 Neurotrophin signaling pathway     103006545 (HRAS)   09158 Development and regeneration    04360 Axon guidance     103006545 (HRAS)   09149 Aging    04211 Longevity regulating pathway     103006545 (HRAS)    04213 Longevity regulating pathway - multiple species     103006545 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     103006545 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103006545 (HRAS)    05206 MicroRNAs in cancer     103006545 (HRAS)    05205 Proteoglycans in cancer     103006545 (HRAS)    05203 Viral carcinogenesis     103006545 (HRAS)    05230 Central carbon metabolism in cancer     103006545 (HRAS)    05231 Choline metabolism in cancer     103006545 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103006545 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103006545 (HRAS)    05225 Hepatocellular carcinoma     103006545 (HRAS)    05226 Gastric cancer     103006545 (HRAS)    05214 Glioma     103006545 (HRAS)    05216 Thyroid cancer     103006545 (HRAS)    05221 Acute myeloid leukemia     103006545 (HRAS)    05220 Chronic myeloid leukemia     103006545 (HRAS)    05218 Melanoma     103006545 (HRAS)    05211 Renal cell carcinoma     103006545 (HRAS)    05219 Bladder cancer     103006545 (HRAS)    05215 Prostate cancer     103006545 (HRAS)    05213 Endometrial cancer     103006545 (HRAS)    05224 Breast cancer     103006545 (HRAS)    05223 Non-small cell lung cancer     103006545 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103006545 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     103006545 (HRAS)   09165 Substance dependence    05034 Alcoholism     103006545 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103006545 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103006545 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103006545 (HRAS)    05170 Human immunodeficiency virus 1 infection     103006545 (HRAS)    05161 Hepatitis B     103006545 (HRAS)    05160 Hepatitis C     103006545 (HRAS)    05163 Human cytomegalovirus infection     103006545 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103006545 (HRAS)    05165 Human papillomavirus infection     103006545 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103006545 (HRAS)    01522 Endocrine resistance     103006545 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bacu04131]     103006545 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bacu04147]     103006545 (HRAS)    04031 GTP-binding proteins [BR:bacu04031]     103006545 (HRAS) Membrane trafficking [BR:bacu04131]  Endocytosis   Macropinocytosis    Ras GTPases     103006545 (HRAS) Exosome [BR:bacu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103006545 (HRAS)   Exosomal proteins of colorectal cancer cells    103006545 (HRAS) GTP-binding proteins [BR:bacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103006545 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase Gtr1_RagA Septin AAA_22 FeoB_N Ldh_1_N Motif Other DBs NCBI-GeneID:  103006545 NCBI-ProteinID:  XP_007171255 UniProt:  A0A383Z7Q9 LinkDB All DBs Position Un AA seq 196 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYSIPYIETSAKTRQPLWLWLQLRDPLGPSGTPVTQQPLSLAWRM PSTRWCARSGSTRRAS NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgctggaggcgtggggaagagcgccctgacc atccagctcatccagaaccactttgtggatgagtacgaccccaccatagaggactcctac cggaagcaagtggtcattgatggggagacttgcctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt gtgtttgccatcaacaacgccaagtccttcgaggacatccaccagtacagggagcagatc aaacgggtgaaggactcagacgatgtgcccatggtgctggtggggaacaagtgtgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacagcatcccc tacatcgagacctcggccaagacgcgtcagccgctctggctctggctccagctccgggac cctctgggaccctccgggacccccgtgacccagcagcccctctcgctggcgtggaggatg ccttctacacgctggtgcgcgagatccggcagcacaaggcgcgcaagctga

Balaenoptera acutorostrata scammoni (minke whale): 103008711 Help Entry 103008711         CDS       T03086                                  Gene name RRAS2 Definition (RefSeq) related RAS viral (r-ras) oncogene homolog 2   KO K07830   Ras-related protein R-Ras2 Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04010   MAPK signaling pathway bacu04014   Ras signaling pathway bacu04024   cAMP signaling pathway bacu04072   Phospholipase D signaling pathway bacu04137   Mitophagy - animal bacu04140   Autophagy - animal bacu04218   Cellular senescence bacu04371   Apelin signaling pathway bacu04625   C-type lectin receptor signaling pathway bacu04810   Regulation of actin cytoskeleton bacu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103008711 (RRAS2)    04014 Ras signaling pathway     103008711 (RRAS2)    04371 Apelin signaling pathway     103008711 (RRAS2)    04072 Phospholipase D signaling pathway     103008711 (RRAS2)    04024 cAMP signaling pathway     103008711 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103008711 (RRAS2)    04137 Mitophagy - animal     103008711 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     103008711 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103008711 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103008711 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103008711 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:bacu04147]     103008711 (RRAS2)    04031 GTP-binding proteins [BR:bacu04031]     103008711 (RRAS2) Exosome [BR:bacu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103008711 (RRAS2)   Exosomal proteins of bladder cancer cells    103008711 (RRAS2) GTP-binding proteins [BR:bacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103008711 (RRAS2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf ATP_bind_1 NPHI_C Motif Other DBs NCBI-GeneID:  103008711 NCBI-ProteinID:  XP_007174953 UniProt:  A0A383ZII0 LinkDB All DBs Position Un AA seq 169 aa AA seqDB search MSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSV TDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYME ASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtcctattttgtaacggattatgatccaaccatcgaggattcctacacaaagcagtgc gtgatagatgaccgggcagcccggctagatattctggatacagcgggacaagaggagttt ggagctatgagagaacagtatatgagaactggcgagggtttcctgttggtcttttcagtc acagatagaggcagttttgaagaaatctataagtttcaaagacagattctcagagtaaag gatcgtgatgagtttccaatgattttaattggtaataaagcagatctggatcatcagaga caggtaacgcaggaagaaggacagcagttagcacgacaacttaaggtaacatacatggag gcatcagcaaagattaggatgaatgtagatcaagctttccatgaacttgtccgggttata aggaaatttcaggagcaggaatgtcctccttcaccagaaccaacacggaaagaaaaagac aagaaaggctgccactgtgtcattttctaa

Balaenoptera acutorostrata scammoni (minke whale): 103010530 Help Entry 103010530         CDS       T03086                                  Gene name RRAS Definition (RefSeq) related RAS viral (r-ras) oncogene homolog   KO K07829   Ras-related protein R-Ras Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04010   MAPK signaling pathway bacu04014   Ras signaling pathway bacu04015   Rap1 signaling pathway bacu04024   cAMP signaling pathway bacu04072   Phospholipase D signaling pathway bacu04137   Mitophagy - animal bacu04140   Autophagy - animal bacu04218   Cellular senescence bacu04360   Axon guidance bacu04371   Apelin signaling pathway bacu04625   C-type lectin receptor signaling pathway bacu04810   Regulation of actin cytoskeleton bacu05132   Salmonella infection bacu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103010530 (RRAS)    04014 Ras signaling pathway     103010530 (RRAS)    04015 Rap1 signaling pathway     103010530 (RRAS)    04371 Apelin signaling pathway     103010530 (RRAS)    04072 Phospholipase D signaling pathway     103010530 (RRAS)    04024 cAMP signaling pathway     103010530 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103010530 (RRAS)    04137 Mitophagy - animal     103010530 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     103010530 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103010530 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103010530 (RRAS)   09158 Development and regeneration    04360 Axon guidance     103010530 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103010530 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103010530 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bacu04031]     103010530 (RRAS) GTP-binding proteins [BR:bacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103010530 (RRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Motif Other DBs NCBI-GeneID:  103010530 NCBI-ProteinID:  XP_007168464 LinkDB All DBs Position Un AA seq 231 aa AA seqDB search MPHSQDCNRDVGNVLYTRKTGPGDRERSLGRAMGRDRDPERGRQTQKRGRDPEGGGPRKS GLRGRATSPLLGHCSKGVLFPPHQSYFVSDYDPTIEDSYTKICMVDGVPARLDILDTAGQ EEFGAMREQYMRAGHGFLLVFAINDRQSPIVLVGNKADLETQRQVPRSEASTFSASHHVA YFEASAKLRLNVDEAFEQLVRAVRKYQEQELPPCPPSAPRKKDGGCPCVLL NT seq 696 nt NT seq  +upstreamnt  +downstreamnt atgccacatagccaggattgtaatcgtgatgtgggaaatgtactttataccagaaaaacg ggaccaggagacagagagaggagcctgggaagggccatgggaagggacagagacccagag agagggagacagactcaaaagaggggaagagacccagaaggaggggggccgagaaagtcg gggctcagaggcagggcgacatcacctctgctgggacactgcagtaaaggtgtcctcttc ccaccccaccagtcctacttcgtgtctgactacgaccccactattgaagactcctacacg aagatctgcatggtggatggcgtcccagcccgcctagacatcctggacaccgccggccag gaggagttcggtgctatgcgggagcagtacatgcgcgccggccatggcttcctgctggtg tttgccattaacgaccggcagagccccatcgtgttggtcgggaacaaggcagatctggag acacagcgccaggttccccgatccgaagcctccaccttcagcgcctcccaccacgtggcc tactttgaggcctcggccaaactgcgcctcaatgtggacgaggccttcgagcagctggtg cgggctgtccggaagtaccaggaacaagagctcccgccctgcccgcccagcgcccccagg aagaaggacgggggttgcccctgcgtcctcctgtag

Balaenoptera acutorostrata scammoni (minke whale): 103015457 Help Entry 103015457         CDS       T03086                                  Gene name KRAS Definition (RefSeq) KRAS proto-oncogene, GTPase   KO K07827   GTPase KRas Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu01521   EGFR tyrosine kinase inhibitor resistance bacu01522   Endocrine resistance bacu04010   MAPK signaling pathway bacu04012   ErbB signaling pathway bacu04014   Ras signaling pathway bacu04015   Rap1 signaling pathway bacu04062   Chemokine signaling pathway bacu04068   FoxO signaling pathway bacu04071   Sphingolipid signaling pathway bacu04072   Phospholipase D signaling pathway bacu04137   Mitophagy - animal bacu04140   Autophagy - animal bacu04150   mTOR signaling pathway bacu04151   PI3K-Akt signaling pathway bacu04210   Apoptosis bacu04211   Longevity regulating pathway bacu04213   Longevity regulating pathway - multiple species bacu04218   Cellular senescence bacu04360   Axon guidance bacu04370   VEGF signaling pathway bacu04371   Apelin signaling pathway bacu04540   Gap junction bacu04550   Signaling pathways regulating pluripotency of stem cells bacu04625   C-type lectin receptor signaling pathway bacu04650   Natural killer cell mediated cytotoxicity bacu04660   T cell receptor signaling pathway bacu04662   B cell receptor signaling pathway bacu04664   Fc epsilon RI signaling pathway bacu04714   Thermogenesis bacu04720   Long-term potentiation bacu04722   Neurotrophin signaling pathway bacu04725   Cholinergic synapse bacu04726   Serotonergic synapse bacu04730   Long-term depression bacu04810   Regulation of actin cytoskeleton bacu04910   Insulin signaling pathway bacu04912   GnRH signaling pathway bacu04914   Progesterone-mediated oocyte maturation bacu04915   Estrogen signaling pathway bacu04916   Melanogenesis bacu04917   Prolactin signaling pathway bacu04919   Thyroid hormone signaling pathway bacu04921   Oxytocin signaling pathway bacu04926   Relaxin signaling pathway bacu04929   GnRH secretion bacu04933   AGE-RAGE signaling pathway in diabetic complications bacu04935   Growth hormone synthesis, secretion and action bacu04960   Aldosterone-regulated sodium reabsorption bacu05010   Alzheimer disease bacu05022   Pathways of neurodegeneration - multiple diseases bacu05034   Alcoholism bacu05160   Hepatitis C bacu05161   Hepatitis B bacu05163   Human cytomegalovirus infection bacu05165   Human papillomavirus infection bacu05166   Human T-cell leukemia virus 1 infection bacu05167   Kaposi sarcoma-associated herpesvirus infection bacu05170   Human immunodeficiency virus 1 infection bacu05200   Pathways in cancer bacu05203   Viral carcinogenesis bacu05205   Proteoglycans in cancer bacu05206   MicroRNAs in cancer bacu05210   Colorectal cancer bacu05211   Renal cell carcinoma bacu05212   Pancreatic cancer bacu05213   Endometrial cancer bacu05214   Glioma bacu05215   Prostate cancer bacu05216   Thyroid cancer bacu05218   Melanoma bacu05219   Bladder cancer bacu05220   Chronic myeloid leukemia bacu05221   Acute myeloid leukemia bacu05223   Non-small cell lung cancer bacu05224   Breast cancer bacu05225   Hepatocellular carcinoma bacu05226   Gastric cancer bacu05230   Central carbon metabolism in cancer bacu05231   Choline metabolism in cancer bacu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103015457 (KRAS)    04012 ErbB signaling pathway     103015457 (KRAS)    04014 Ras signaling pathway     103015457 (KRAS)    04015 Rap1 signaling pathway     103015457 (KRAS)    04370 VEGF signaling pathway     103015457 (KRAS)    04371 Apelin signaling pathway     103015457 (KRAS)    04068 FoxO signaling pathway     103015457 (KRAS)    04072 Phospholipase D signaling pathway     103015457 (KRAS)    04071 Sphingolipid signaling pathway     103015457 (KRAS)    04151 PI3K-Akt signaling pathway     103015457 (KRAS)    04150 mTOR signaling pathway     103015457 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103015457 (KRAS)    04137 Mitophagy - animal     103015457 (KRAS)   09143 Cell growth and death    04210 Apoptosis     103015457 (KRAS)    04218 Cellular senescence     103015457 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103015457 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103015457 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103015457 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103015457 (KRAS)    04650 Natural killer cell mediated cytotoxicity     103015457 (KRAS)    04660 T cell receptor signaling pathway     103015457 (KRAS)    04662 B cell receptor signaling pathway     103015457 (KRAS)    04664 Fc epsilon RI signaling pathway     103015457 (KRAS)    04062 Chemokine signaling pathway     103015457 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103015457 (KRAS)    04929 GnRH secretion     103015457 (KRAS)    04912 GnRH signaling pathway     103015457 (KRAS)    04915 Estrogen signaling pathway     103015457 (KRAS)    04914 Progesterone-mediated oocyte maturation     103015457 (KRAS)    04917 Prolactin signaling pathway     103015457 (KRAS)    04921 Oxytocin signaling pathway     103015457 (KRAS)    04926 Relaxin signaling pathway     103015457 (KRAS)    04935 Growth hormone synthesis, secretion and action     103015457 (KRAS)    04919 Thyroid hormone signaling pathway     103015457 (KRAS)    04916 Melanogenesis     103015457 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     103015457 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     103015457 (KRAS)    04726 Serotonergic synapse     103015457 (KRAS)    04720 Long-term potentiation     103015457 (KRAS)    04730 Long-term depression     103015457 (KRAS)    04722 Neurotrophin signaling pathway     103015457 (KRAS)   09158 Development and regeneration    04360 Axon guidance     103015457 (KRAS)   09149 Aging    04211 Longevity regulating pathway     103015457 (KRAS)    04213 Longevity regulating pathway - multiple species     103015457 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     103015457 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103015457 (KRAS)    05206 MicroRNAs in cancer     103015457 (KRAS)    05205 Proteoglycans in cancer     103015457 (KRAS)    05203 Viral carcinogenesis     103015457 (KRAS)    05230 Central carbon metabolism in cancer     103015457 (KRAS)    05231 Choline metabolism in cancer     103015457 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103015457 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103015457 (KRAS)    05212 Pancreatic cancer     103015457 (KRAS)    05225 Hepatocellular carcinoma     103015457 (KRAS)    05226 Gastric cancer     103015457 (KRAS)    05214 Glioma     103015457 (KRAS)    05216 Thyroid cancer     103015457 (KRAS)    05221 Acute myeloid leukemia     103015457 (KRAS)    05220 Chronic myeloid leukemia     103015457 (KRAS)    05218 Melanoma     103015457 (KRAS)    05211 Renal cell carcinoma     103015457 (KRAS)    05219 Bladder cancer     103015457 (KRAS)    05215 Prostate cancer     103015457 (KRAS)    05213 Endometrial cancer     103015457 (KRAS)    05224 Breast cancer     103015457 (KRAS)    05223 Non-small cell lung cancer     103015457 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103015457 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     103015457 (KRAS)   09165 Substance dependence    05034 Alcoholism     103015457 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103015457 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103015457 (KRAS)    05170 Human immunodeficiency virus 1 infection     103015457 (KRAS)    05161 Hepatitis B     103015457 (KRAS)    05160 Hepatitis C     103015457 (KRAS)    05163 Human cytomegalovirus infection     103015457 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103015457 (KRAS)    05165 Human papillomavirus infection     103015457 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103015457 (KRAS)    01522 Endocrine resistance     103015457 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:bacu04131]     103015457 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bacu04031]     103015457 (KRAS) Membrane trafficking [BR:bacu04131]  Endocytosis   Macropinocytosis    Ras GTPases     103015457 (KRAS) GTP-binding proteins [BR:bacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103015457 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin AAA_25 CbiA Motif Other DBs NCBI-GeneID:  103015457 NCBI-ProteinID:  XP_007194917 UniProt:  A0A384B5V8 LinkDB All DBs Position Un AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac agaaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct tttattgaaacatctgcaaagacaagacagagagtggaggatgctttttatacattggtg agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattgtaatgtaa

Balaenoptera acutorostrata scammoni (minke whale): 103016009 Help Entry 103016009         CDS       T03086                                  Gene name MRAS Definition (RefSeq) muscle RAS oncogene homolog   KO K07831   Ras-related protein M-Ras Organism bacu  Balaenoptera acutorostrata scammoni (minke whale) Pathway bacu04010   MAPK signaling pathway bacu04014   Ras signaling pathway bacu04015   Rap1 signaling pathway bacu04072   Phospholipase D signaling pathway bacu04137   Mitophagy - animal bacu04140   Autophagy - animal bacu04218   Cellular senescence bacu04371   Apelin signaling pathway bacu04625   C-type lectin receptor signaling pathway bacu04810   Regulation of actin cytoskeleton bacu05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:bacu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103016009 (MRAS)    04014 Ras signaling pathway     103016009 (MRAS)    04015 Rap1 signaling pathway     103016009 (MRAS)    04371 Apelin signaling pathway     103016009 (MRAS)    04072 Phospholipase D signaling pathway     103016009 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103016009 (MRAS)    04137 Mitophagy - animal     103016009 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     103016009 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103016009 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103016009 (MRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103016009 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:bacu04031]     103016009 (MRAS) GTP-binding proteins [BR:bacu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103016009 (MRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 Gtr1_RagA AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  103016009 NCBI-ProteinID:  XP_007170396 UniProt:  A0A383Z5M2 LinkDB All DBs Position Un AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDNQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGKEMATKHNIPYIETSAKDPPLNVDRAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGTHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcgaccagtgccgtccccagcgacaacctccccacgtacaagctggtggtggtggga gacgggggtgtgggcaagagcgccctcaccatccagtttttccagaagatctttgtgcct gactatgaccccaccatcgaagactcctacctgaagcatacagagattgacaaccagtgg gccatcttagacgttctggacacagccggacaggaggagttcagcgccatgcgggagcag tacatgcgcacgggggacggcttcctcatcgtcttctcggtcacggacaaggccagcttc gagcacgtggaccgcttccaccagctcatcctgcgcgtcaaggacagggagtcattcccg atgatcctagtggccaacaaggtcgatttgatgcatttgaggaaaatcaccagggagcaa ggaaaagaaatggccaccaaacacaatattccgtacatagaaaccagtgccaaggaccca cctctcaacgtcgacagagccttccatgacctggttagagtaattaggcaacagattccg gaaaaaagccagaagaagaagaagaaaaccaaatggcggggagaccgggccactggcacc cacaaactgcagtgcgtgatattgtga

DBGET integrated database retrieval system