KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005004
Entry
103005004         CDS       T03086                                 

Gene name
ACTG1
Definition
(RefSeq) actin gamma 1
  KO
K05692  actin beta/gamma 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04145  Phagosome
bacu04210  Apoptosis
bacu04390  Hippo signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04670  Leukocyte transendothelial migration
bacu04714  Thermogenesis
bacu04810  Regulation of actin cytoskeleton
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04971  Gastric acid secretion
bacu05014  Amyotrophic lateral sclerosis
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05164  Influenza A
bacu05205  Proteoglycans in cancer
bacu05225  Hepatocellular carcinoma
bacu05410  Hypertrophic cardiomyopathy
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
bacu05414  Dilated cardiomyopathy
bacu05416  Viral myocarditis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103005004 (ACTG1)
   04390 Hippo signaling pathway
    103005004 (ACTG1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103005004 (ACTG1)
  09143 Cell growth and death
   04210 Apoptosis
    103005004 (ACTG1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103005004 (ACTG1)
   04520 Adherens junction
    103005004 (ACTG1)
   04530 Tight junction
    103005004 (ACTG1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103005004 (ACTG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103005004 (ACTG1)
   04613  Neutrophil extracellular trap formation
    103005004 (ACTG1)
   04670 Leukocyte transendothelial migration
    103005004 (ACTG1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103005004 (ACTG1)
   04919 Thyroid hormone signaling pathway
    103005004 (ACTG1)
  09154 Digestive system
   04971 Gastric acid secretion
    103005004 (ACTG1)
  09159 Environmental adaptation
   04714 Thermogenesis
    103005004 (ACTG1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103005004 (ACTG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103005004 (ACTG1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103005004 (ACTG1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103005004 (ACTG1)
   05410 Hypertrophic cardiomyopathy
    103005004 (ACTG1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103005004 (ACTG1)
   05414 Dilated cardiomyopathy
    103005004 (ACTG1)
   05416 Viral myocarditis
    103005004 (ACTG1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103005004 (ACTG1)
   05135 Yersinia infection
    103005004 (ACTG1)
   05100 Bacterial invasion of epithelial cells
    103005004 (ACTG1)
  09172 Infectious disease: viral
   05164 Influenza A
    103005004 (ACTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bacu03021]
    103005004 (ACTG1)
   03019 Messenger RNA biogenesis [BR:bacu03019]
    103005004 (ACTG1)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103005004 (ACTG1)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103005004 (ACTG1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103005004 (ACTG1)
   04147 Exosome [BR:bacu04147]
    103005004 (ACTG1)
Transcription machinery [BR:bacu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     103005004 (ACTG1)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103005004 (ACTG1)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     103005004 (ACTG1)
    NuA4 complex
     103005004 (ACTG1)
  Chromatin remodeling factors
   BAF complex
    103005004 (ACTG1)
   PBAF complex
    103005004 (ACTG1)
   SWR1 complex
    103005004 (ACTG1)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    103005004 (ACTG1)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     103005004 (ACTG1)
Exosome [BR:bacu04147]
 Exosomal proteins
  Proteins found in most exosomes
   103005004 (ACTG1)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 103005004
NCBI-ProteinID: XP_007185913
UniProt: A0A384AF15
LinkDB
Position
Un
AA seq 375 aa
MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT
QIMFETFNTPAMYVAIQAVLSLYASGCTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL
AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY
ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS
GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaagaaatcgccgcgctcgtcattgacaatggctctggcatgtgcaaagcgggc
tttgctggggatgacgctccccgggccgtcttcccgtccatcgttgggcgtccccgacac
cagggcgtcatggtgggcatggggcagaaggacagctacgtgggcgacgaggcccagagc
aagcgtggcatcctgactctcaagtaccccattgagcatggcatcgtcaccaattgggac
gacatggagaagatttggcaccacactttctataacgagctgcgtgtggcccccgaggag
caccccgtgctgctgacggaggcccccctgaaccccaaggccaaccgtgagaagatgacc
cagatcatgttcgagactttcaacactccggccatgtacgtggccatccaggctgtgctg
tccctgtacgcttctggctgcaccactggtatagtcatggactctggggatggggtcacc
cacacggtgcccatctacgaggggtatgccctcccccacgccatcttgcgtctggacctg
gctggccgggacctgacagactacctcatgaagatcctcacggagcgtggttacagcttc
accaccacagccgagcgggaaatcgtgcgtgatatcaaggagaagctctgctacgttgcc
ctggacttcgagcaggagatggccaccgccgcgtcctcctcctccttggagaagagctat
gagctgcctgatggtcaggtgatcaccatcggcaacgagcggttccggtgtccagaggcg
ctcttccagccctccttcttgggtatggagtcctgtggcatccacgagactaccttcaac
tctatcatgaagtgtgatgtcgacatccggaaggacctctatgccaacacagtgctgtct
ggtgggaccaccatgtatcccggcatcgctgacaggatgcagaaggagatcacggctctg
gcccccagcacaatgaagatcaagattatcgctcctcccgagcgcaagtactcggtgtgg
atcgggggctccatcctggcctcgctgtccaccttccagcagatgtggatcagcaagcag
gagtacgacgagtcgggcccctccatcgtccaccgcaaatgcttctaa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103015338
Entry
103015338         CDS       T03086                                 

Gene name
ACTB
Definition
(RefSeq) actin beta
  KO
K05692  actin beta/gamma 1
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04015  Rap1 signaling pathway
bacu04145  Phagosome
bacu04210  Apoptosis
bacu04390  Hippo signaling pathway
bacu04510  Focal adhesion
bacu04520  Adherens junction
bacu04530  Tight junction
bacu04611  Platelet activation
bacu04613  Neutrophil extracellular trap formation
bacu04670  Leukocyte transendothelial migration
bacu04714  Thermogenesis
bacu04810  Regulation of actin cytoskeleton
bacu04919  Thyroid hormone signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04971  Gastric acid secretion
bacu05014  Amyotrophic lateral sclerosis
bacu05100  Bacterial invasion of epithelial cells
bacu05132  Salmonella infection
bacu05135  Yersinia infection
bacu05164  Influenza A
bacu05205  Proteoglycans in cancer
bacu05225  Hepatocellular carcinoma
bacu05410  Hypertrophic cardiomyopathy
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
bacu05414  Dilated cardiomyopathy
bacu05416  Viral myocarditis
bacu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103015338 (ACTB)
   04390 Hippo signaling pathway
    103015338 (ACTB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    103015338 (ACTB)
  09143 Cell growth and death
   04210 Apoptosis
    103015338 (ACTB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103015338 (ACTB)
   04520 Adherens junction
    103015338 (ACTB)
   04530 Tight junction
    103015338 (ACTB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103015338 (ACTB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103015338 (ACTB)
   04613  Neutrophil extracellular trap formation
    103015338 (ACTB)
   04670 Leukocyte transendothelial migration
    103015338 (ACTB)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103015338 (ACTB)
   04919 Thyroid hormone signaling pathway
    103015338 (ACTB)
  09154 Digestive system
   04971 Gastric acid secretion
    103015338 (ACTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    103015338 (ACTB)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    103015338 (ACTB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103015338 (ACTB)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103015338 (ACTB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103015338 (ACTB)
   05410 Hypertrophic cardiomyopathy
    103015338 (ACTB)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103015338 (ACTB)
   05414 Dilated cardiomyopathy
    103015338 (ACTB)
   05416 Viral myocarditis
    103015338 (ACTB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103015338 (ACTB)
   05135 Yersinia infection
    103015338 (ACTB)
   05100 Bacterial invasion of epithelial cells
    103015338 (ACTB)
  09172 Infectious disease: viral
   05164 Influenza A
    103015338 (ACTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bacu03021]
    103015338 (ACTB)
   03019 Messenger RNA biogenesis [BR:bacu03019]
    103015338 (ACTB)
   03036 Chromosome and associated proteins [BR:bacu03036]
    103015338 (ACTB)
   03029 Mitochondrial biogenesis [BR:bacu03029]
    103015338 (ACTB)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bacu04812]
    103015338 (ACTB)
   04147 Exosome [BR:bacu04147]
    103015338 (ACTB)
Transcription machinery [BR:bacu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     103015338 (ACTB)
Messenger RNA biogenesis [BR:bacu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103015338 (ACTB)
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     103015338 (ACTB)
    NuA4 complex
     103015338 (ACTB)
  Chromatin remodeling factors
   BAF complex
    103015338 (ACTB)
   PBAF complex
    103015338 (ACTB)
   SWR1 complex
    103015338 (ACTB)
Mitochondrial biogenesis [BR:bacu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    103015338 (ACTB)
Cytoskeleton proteins [BR:bacu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     103015338 (ACTB)
Exosome [BR:bacu04147]
 Exosomal proteins
  Proteins found in most exosomes
   103015338 (ACTB)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 103015338
NCBI-ProteinID: XP_007186830
UniProt: A0A384AHN3
LinkDB
Position
Un
AA seq 384 aa
MVLVSPRFAMDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKD
SYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLN
PKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYAL
PHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAA
SSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRK
DLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLST
FQQMWISKQEYDESGPSIVHRKCF
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggtcctggtctccccgcggttcgccatggatgacgatattgctgcgcttgtggtcgac
aacggctccggcatgtgcaaggccggcttcgcgggtgacgatgctccccgggccgtcttc
ccctccatcgtggggcgcccccggcaccagggcgtgatggtgggcatgggccagaaggac
tcctatgtgggtgatgaggcccagagcaagagaggcatcctgaccctcaagtaccccatc
gaacacggcatcgtcaccaactgggacgacatggagaagatctggcaccacaccttctac
aacgagctgcgtgtggcccccgaggagcaccccgttctgctgaccgaggcccccctgaac
cccaaggccaaccgtgagaagatgacccagatcatgttcgagaccttcaacaccccagcc
atgtacgtggccatccaggctgtgctgtccttgtacgcctctggccgcaccactggcatc
gtgatggactccggtgatggggtcacccacacggtgcctatctacgaggggtacgccctc
ccccacgccatcctgcgtctggacctggctggccgggacctgacggactacctcatgaag
atcctcacggagcgtggctacagcttcaccaccacggccgagcgggaaatcgtacgtgac
atcaaggagaagctctgctacgtcgccctggacttcgagcaggagatggccaccgcggcc
tccagctcctccctggagaagagctacgagctgcccgatggtcaggtcatcaccattggc
aacgagcggttccgctgccctgaggctctcttccagccttccttcctgggcatggaatcc
tgtggcatccacgaaactaccttcaattccatcatgaagtgtgacgtcgacatccgcaag
gacctctatgccaacacggtgctgtctggcgggaccaccatgtacccaggcatcgccgac
aggatgcagaaggagatcaccgccctggctcccagcacgatgaagatcaagatcatcgcc
ccgcccgagcgcaagtactccgtgtggatcggcggctccatcctggcctcgctgtccacc
ttccagcagatgtggatcagcaagcaggagtacgacgagtccggcccctccatcgtccac
cgcaaatgcttctag

DBGET integrated database retrieval system