KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005047Help
Entry
103005047         CDS       T03086                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu00020  Citrate cycle (TCA cycle)
bacu00190  Oxidative phosphorylation
bacu01100  Metabolic pathways
bacu01200  Carbon metabolism
bacu04714  Thermogenesis
bacu04932  Non-alcoholic fatty liver disease (NAFLD)
bacu05010  Alzheimer disease
bacu05012  Parkinson disease
bacu05016  Huntington disease
Module
bacu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bacu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bacu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103005047 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103005047 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    103005047 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    103005047 (SDHA)
   05012 Parkinson disease
    103005047 (SDHA)
   05016 Huntington disease
    103005047 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    103005047 (SDHA)
Enzymes [BR:bacu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103005047 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 103005047
NCBI-ProteinID: XP_007191728
UniProt: A0A384AWT0
LinkDB All DBs
Position
Un
AA seq 700 aa AA seqDB search
MCAGVESRLTTVGPGRGDVRRRGLRGGLAGRRWRADMSGIGVVSRLLRARRLALTWARPA
ALQTGARSFHFTVDSSKRSSAKVSDAISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAG
FNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTE
QAPASVVELENYGMPFSRTEGGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTL
YGRSLRYDTSYFVEYFALDLLMENGECRGIIALCIEDGSIHRIRAKNTVVATGGYGRTYF
SCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILVNSQGE
RXXXXXXXXXXXLASRDVVSRSMTLEIRAGRGCGPEKDHVYLQLHHLPPEQLAMRLPGIS
ETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVLKHVDGQDQIVPGLYACGEAACA
SVHGANRLGANSLLDLVVFGRACALSIAESCRPGDKVPLIKPNAGEESVMNLDKLRFANG
SIRTSELRLNMQKSMQSHAAVFRVGSVLQEGCEKISQLYGDLKHLKTFDRGMVWNTDLVE
TLELQNLMLCALQTIYGAEARKESRGAHAREDFKERVDEYDYAKPIQGQHKKPFEEHWRK
HTLSCVDVTTGKVSLEYRPVIDRTLNEADCATVPPAIRSY
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgcaggcgtggagtcccgcctcaccaccgtcggccccgggcgcggcgacgtgcgc
aggcgcggtctgcgcgggggactggcgggacggcggtggagggcagacatgtcggggatc
ggggttgtgtcgcggcttctgcgcgcccggcgcctagcgctgacctgggcgcggccagca
gcattgcagacaggagcccgcagttttcacttcaccgttgacagcagtaagaggtcgtcc
gctaaagtttcagatgcaatttctacgcagtacccagtagtggatcatgaattcgatgca
gtggtggtcggcgccggaggggcaggcctgcgagctgcatttggcctttctgaagcaggg
tttaacacggcctgcgtcacaaagctctttcccaccaggtcacacactgtcgcagcccag
ggagggatcaacgccgccctggggaacatggaggaggacaactggaggtggcacttctac
gacactgtgaagggctccgactggctgggggaccaggatgccatccactacatgacggag
caggccccggcctcggtggtggagctggagaattacggcatgccatttagcagaactgaa
ggtgggaagatctaccagcgtgcctttggtgggcagagcctccagtttgggaaaggcggg
caggcccatcgctgttgctgcgtggccgaccgcactggccactcgctgctgcacactttg
tatggaaggtctctgcgatacgataccagctattttgtggagtattttgccttggacctc
ctgatggagaacggggagtgtcgaggcattattgctctgtgcatagaagacgggtccatc
caccgcatcagagcaaagaacactgttgtagccactggaggctacgggcgcacctacttc
agctgcacctccgcccacaccagcaccggggacggcactgccatgatcaccagggcaggc
cttccctgccaggacctggagtttgttcagttccaccccacaggcatatacggtgctggc
tgtctcatcacggaagggtgccgtggagagggaggcatcctcgtcaacagtcaaggcgag
cgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnccctggcgtccagggacgtcgtctcc
cgctccatgaccctggagatccgtgcaggaagaggctgtggccctgagaaggatcacgtg
tacctgcagctgcaccacctcccgcctgaacagctggctatgcgcctgcctggcatctca
gagacagccatgatcttcgcgggtgtggacgtcaccaaggagccgattcccgtgcttccc
accgtgcactacaacatgggcggcatccccaccaactacaaggggcaggttctgaagcac
gtggacggccaggatcagatcgtgcccggcctgtacgcgtgtggggaggctgcctgcgcc
tcggtgcacggtgccaaccgcctgggggcaaactcgctcctggacctggtcgtcttcggc
cgggcgtgcgccctgagcatcgcagagtcctgcagacccggagataaagttcccttgatt
aaaccaaatgctggggaagaatctgtcatgaatcttgacaaattgagatttgccaatgga
agcataagaacatcggaactacggctgaacatgcagaagtcgatgcaaagtcatgccgca
gtgttccgtgtgggaagcgtgttacaggaaggctgtgagaagatcagccagctctatgga
gatctaaagcatctgaagacgtttgacaggggaatggtctggaacactgacctggtggag
accctggagctgcagaacctgatgctttgtgccctgcagaccatttatggagcagaggcc
cggaaggagtctcgcggcgctcatgccagggaggatttcaaggagcgggttgacgagtat
gattacgccaagcccatccaggggcagcacaagaagccgtttgaggagcactggaggaag
cacacgctctcttgcgtggacgtcacgactgggaaggtctccctggaatacagacccgta
atcgacagaactctgaacgaggctgactgcgccactgtccccccagccatccgctcctac
tga

DBGET integrated database retrieval system