KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005078
Entry
103005078         CDS       T03086                                 

Gene name
SMAD2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04110  Cell cycle
bacu04144  Endocytosis
bacu04218  Cellular senescence
bacu04350  TGF-beta signaling pathway
bacu04371  Apelin signaling pathway
bacu04390  Hippo signaling pathway
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04659  Th17 cell differentiation
bacu04926  Relaxin signaling pathway
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05142  Chagas disease
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05205  Proteoglycans in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    103005078 (SMAD2)
   04390 Hippo signaling pathway
    103005078 (SMAD2)
   04371 Apelin signaling pathway
    103005078 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103005078 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    103005078 (SMAD2)
   04218 Cellular senescence
    103005078 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103005078 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103005078 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    103005078 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005078 (SMAD2)
   05205 Proteoglycans in cancer
    103005078 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103005078 (SMAD2)
   05212 Pancreatic cancer
    103005078 (SMAD2)
   05225 Hepatocellular carcinoma
    103005078 (SMAD2)
   05226 Gastric cancer
    103005078 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103005078 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103005078 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103005078 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    103005078 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103005078
NCBI-ProteinID: XP_007197271
UniProt: A0A384BC53
LinkDB
Position
Un
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAAIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTSLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccaccagttgtgaagagactgctgggatggaaaaaa
tcagctggtggatctggaggagcaggtggtggagagcagaatggacaggaagaaaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtatctcatcgg
aaaggactgccgcacgtaatatattgccgattatggcgctggcctgatcttcacagtcat
catgaactcaaggcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttttgcctccggtgttagtg
ccacggcatactgagatcttaacagaactaccacctctggatgattatacccactccatt
ccagaaaacactaatttcccagcagcaattgagccacagagtaattatatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactgtctcctacttctctttcccctgttaatcatagt
ttggatttgcagcctgttacttactcagaacctgcattttggtgttcaatagcgtattat
gaattaaaccagagggttggagagaccttccatgcatcacagccctcactcaccgtagac
ggcttcacagatccatcaaattcagagaggttctgcctaggtttactctctaacgtcaac
agaaatgctacagtagaaatgacaagaagacatataggaagaggagtgcgcttatattac
ataggtggggaagtttttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aattgtaatcagagatacggctggcaccctgcaacagtgtgtaaaattccaccaggctgt
aacctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtccgttaatcag
ggttttgaagccgtgtatcagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagcactccttgctggattgaactt
catctgaatggacctctacagtggttggacaaagtattaactcagatgggatccccttca
gtgcgttgctcaagcatgtcataa

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103019152
Entry
103019152         CDS       T03086                                 

Gene name
SMAD3
Definition
(RefSeq) SMAD family member 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04144  Endocytosis
bacu04218  Cellular senescence
bacu04310  Wnt signaling pathway
bacu04350  TGF-beta signaling pathway
bacu04371  Apelin signaling pathway
bacu04390  Hippo signaling pathway
bacu04520  Adherens junction
bacu04550  Signaling pathways regulating pluripotency of stem cells
bacu04659  Th17 cell differentiation
bacu04933  AGE-RAGE signaling pathway in diabetic complications
bacu05161  Hepatitis B
bacu05166  Human T-cell leukemia virus 1 infection
bacu05200  Pathways in cancer
bacu05210  Colorectal cancer
bacu05212  Pancreatic cancer
bacu05220  Chronic myeloid leukemia
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
bacu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103019152 (SMAD3)
   04350 TGF-beta signaling pathway
    103019152 (SMAD3)
   04390 Hippo signaling pathway
    103019152 (SMAD3)
   04371 Apelin signaling pathway
    103019152 (SMAD3)
   04068 FoxO signaling pathway
    103019152 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103019152 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    103019152 (SMAD3)
   04218 Cellular senescence
    103019152 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103019152 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    103019152 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    103019152 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103019152 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103019152 (SMAD3)
   05212 Pancreatic cancer
    103019152 (SMAD3)
   05225 Hepatocellular carcinoma
    103019152 (SMAD3)
   05226 Gastric cancer
    103019152 (SMAD3)
   05220 Chronic myeloid leukemia
    103019152 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103019152 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103019152 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103019152 (SMAD3)
   05161 Hepatitis B
    103019152 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103019152
NCBI-ProteinID: XP_007166132
UniProt: A0A383YTC5
LinkDB
Position
Un
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcatcaccatccccaggtccctagatggccggctgcaggtgtcccaccgg
aaggggctcccccatgtcatctactgccgcctgtggcgatggcctgacctacacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaatccctaccactatcagagggtggagaccccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccgctggacgactacagccattccatc
cctgaaaacactaacttccccgccggcattgagccccagagcaatattccagaaacccca
cccccgggctacttgagtgaagatggagagaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctatccccgaatccgatgtccccagcacacaataacttggac
ctgcagcccgtcacctactgcgagccggccttctggtgttccatctcctactacgagctc
aaccagcgtgtcggggagacattccacgcctcgcagccgtccatgacagtggatggcttc
accgatccctccaactcagagcgcttctgcctggggttgctctccaatgttaacaggaat
gcggccgtggagctgacgcggaggcatatcgggcgaggcgtgcggctgtactacattgga
ggcgaggtctttgcagagtgcctcagcgacagtgccatctttgtccagtctcccaactgt
aaccagcgctacggctggcacccagccaccgtctgcaagatcccaccaggatgcaacctg
aagatcttcaacaaccaggagtttgccgccctcctggctcagtctgtcaaccagggcttc
gaggccgtgtaccagctgacccggatgtgcaccatccgcatgagcttcgtcaagggctgg
ggagccgagtacaggagacagaccgtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagcatccgc
tgctccagtgtgtcttag

DBGET integrated database retrieval system