KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005082
Entry
103005082         CDS       T03086                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01522  Endocrine resistance
bacu01524  Platinum drug resistance
bacu04012  ErbB signaling pathway
bacu04066  HIF-1 signaling pathway
bacu04068  FoxO signaling pathway
bacu04110  Cell cycle
bacu04115  p53 signaling pathway
bacu04151  PI3K-Akt signaling pathway
bacu04218  Cellular senescence
bacu04630  JAK-STAT signaling pathway
bacu04921  Oxytocin signaling pathway
bacu04928  Parathyroid hormone synthesis, secretion and action
bacu04934  Cushing syndrome
bacu05160  Hepatitis C
bacu05161  Hepatitis B
bacu05163  Human cytomegalovirus infection
bacu05165  Human papillomavirus infection
bacu05166  Human T-cell leukemia virus 1 infection
bacu05167  Kaposi sarcoma-associated herpesvirus infection
bacu05169  Epstein-Barr virus infection
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05203  Viral carcinogenesis
bacu05205  Proteoglycans in cancer
bacu05206  MicroRNAs in cancer
bacu05210  Colorectal cancer
bacu05211  Renal cell carcinoma
bacu05212  Pancreatic cancer
bacu05213  Endometrial cancer
bacu05214  Glioma
bacu05215  Prostate cancer
bacu05216  Thyroid cancer
bacu05217  Basal cell carcinoma
bacu05218  Melanoma
bacu05219  Bladder cancer
bacu05220  Chronic myeloid leukemia
bacu05222  Small cell lung cancer
bacu05223  Non-small cell lung cancer
bacu05224  Breast cancer
bacu05225  Hepatocellular carcinoma
bacu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103005082 (CDKN1A)
   04630 JAK-STAT signaling pathway
    103005082 (CDKN1A)
   04066 HIF-1 signaling pathway
    103005082 (CDKN1A)
   04068 FoxO signaling pathway
    103005082 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    103005082 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103005082 (CDKN1A)
   04115 p53 signaling pathway
    103005082 (CDKN1A)
   04218 Cellular senescence
    103005082 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    103005082 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    103005082 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005082 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    103005082 (CDKN1A)
   05206 MicroRNAs in cancer
    103005082 (CDKN1A)
   05205 Proteoglycans in cancer
    103005082 (CDKN1A)
   05203 Viral carcinogenesis
    103005082 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103005082 (CDKN1A)
   05212 Pancreatic cancer
    103005082 (CDKN1A)
   05225 Hepatocellular carcinoma
    103005082 (CDKN1A)
   05226 Gastric cancer
    103005082 (CDKN1A)
   05214 Glioma
    103005082 (CDKN1A)
   05216 Thyroid cancer
    103005082 (CDKN1A)
   05220 Chronic myeloid leukemia
    103005082 (CDKN1A)
   05217 Basal cell carcinoma
    103005082 (CDKN1A)
   05218 Melanoma
    103005082 (CDKN1A)
   05211 Renal cell carcinoma
    103005082 (CDKN1A)
   05219 Bladder cancer
    103005082 (CDKN1A)
   05215 Prostate cancer
    103005082 (CDKN1A)
   05213 Endometrial cancer
    103005082 (CDKN1A)
   05224 Breast cancer
    103005082 (CDKN1A)
   05222 Small cell lung cancer
    103005082 (CDKN1A)
   05223 Non-small cell lung cancer
    103005082 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103005082 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103005082 (CDKN1A)
   05161 Hepatitis B
    103005082 (CDKN1A)
   05160 Hepatitis C
    103005082 (CDKN1A)
   05163 Human cytomegalovirus infection
    103005082 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103005082 (CDKN1A)
   05169 Epstein-Barr virus infection
    103005082 (CDKN1A)
   05165 Human papillomavirus infection
    103005082 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103005082 (CDKN1A)
   01522 Endocrine resistance
    103005082 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103005082
NCBI-ProteinID: XP_007198019
UniProt: A0A384BFH3
LinkDB
Position
Un
AA seq 164 aa
MSEPCRDARQIPRSSKACCCLFGPVDSEQLRQDCDAVMASCVQEARERWNFDFVTETPLE
GDFAWERMRGLGLPKLYLPAGPRGTRDDLGGGKWPSTSSALLQGTSQEDHVDLSLSCTLV
SRSPERPEGSPGGPGTSQGRKRRQTSMTDFYHSKRRLISSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagccatgcagggatgcccgtcagatcccgcgcagcagcaaggcgtgctgctgc
ctctttggcccggtggacagcgagcagctgcgccaggactgcgacgccgtgatggccagc
tgcgtgcaggaggcccgagagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgcatgaggggccttggcctgcccaagctctacctgcctgca
gggccccgggggacccgggacgacctgggagggggcaagtggccgagcacctcatctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcgctgtcctgcaccctcgtg
tctcgctcccctgagcggcctgaggggtccccgggagggccgggcacctcccagggacga
aaacggcgacagaccagcatgacagatttctatcactctaaacgccggctgatcagctcc
aagaggaagccctaa

DBGET integrated database retrieval system