KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005164
Entry
103005164         CDS       T03086                                 

Definition
(RefSeq) breast cancer type 1 susceptibility protein homolog
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu03440  Homologous recombination
bacu03460  Fanconi anemia pathway
bacu04120  Ubiquitin mediated proteolysis
bacu04151  PI3K-Akt signaling pathway
bacu05206  MicroRNAs in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103005164
  09124 Replication and repair
   03440 Homologous recombination
    103005164
   03460 Fanconi anemia pathway
    103005164
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103005164
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103005164
  09162 Cancer: specific types
   05224 Breast cancer
    103005164
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103005164
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103005164
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bacu04121]
    103005164
   03036 Chromosome and associated proteins [BR:bacu03036]
    103005164
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103005164
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103005164
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103005164
Ubiquitin system [BR:bacu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    103005164
  Multi subunit Ring-finger type E3
   BRCC complex
    103005164
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     103005164
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     103005164
    BRCA1-A complex
     103005164
    BRCA1-B complex
     103005164
    BRCA1-C complex
     103005164
    BRCA complex
     103005164
   FA (Fanconi anemia) pathway
    Downstream FA components
     103005164
SSDB
Motif
Pfam: BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-Nse BRCT_2 zf-RING_6 zf-RING_10 Prok-RING_4 zf-ANAPC11 zf-rbx1 zf-RING_4
Other DBs
NCBI-GeneID: 103005164
NCBI-ProteinID: XP_007177796
UniProt: A0A383ZRU2
LinkDB
Position
Un
AA seq 758 aa
MDFSADHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITRRSLQESTRFSQLVEEVLKVIHAFELDTGLQIANSYNFSKKENNSPEHLKE
EVSIIQSMGYRNRAKRLRQSAPENPTLQETSLSVQLSNLGIVRSLRTKQQIQPQKKSVYI
ELGSDSSEDTVNKASYCSVGDHELVEITPQGAKAEASLNPAKKAACEFSEKDITKAEHHQ
FSNKDLTTTEKHETEKHPEKYQGEAASEYESETSLSEDCLGLSSQSDILTTQQRDTMQDN
LLKIQQEMAELEAVLEQHGSQPSHSSPSLIADSCAPEDLLNLEQNTSDRVLTSEKSSEYP
IRQNPESLSADKFQVSPDCSTSKNKEPGMERSSPSKSQLSDNRWYMHSHSRSLQNRNCPP
QKELEVVDVEEQQLTESEAQDLTEQSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAP
EPAHSCSMPPSASALKLPQFQVEESARSPAAAHTTNTAGYNVREESVSREKPELISSTQR
GNKRISMVASGLTPKEFVLVHKFARKHHITLTNLITEETTHVIMKTDTEFVCERTLKYFL
GIAGGRWVVSYFWVTQSITERRMLDEHDFEVRGDVVNGRNHQGPKRARESQDRKIFKGLE
ICCYGPFTNMPTDQLEWMVHLCGASVVKEPSSFTLSQGTQPIVVVQPDAWTEGGGFHVIG
QMCEAPVVTREWVLDSVALYQCQELDTYLIPQVPQSCC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggatttttctgcggatcacgttgaagaagtacaaaatgtccttaatgctatgcagaaa
atcttagagtgtccaatctgtctggagttgatcaaagagcctgtttccacaaagtgtgat
cacatattttgcaaattttgtatgctgaaacttctcaaccagaagaaagggccttcacag
tgtcctttgtgtaagaatgatataaccagaagaagcctacaagaaagtacaagatttagt
cagcttgttgaagaggtattgaaggtcattcatgcttttgagcttgacacaggattgcag
attgcaaacagttataacttttcaaaaaaggaaaataactctcctgagcatctgaaggag
gaagtttctatcattcaaagtatgggctaccgaaaccgggccaaaagacttcgacagagt
gcacctgaaaatcctaccttgcaggaaaccagtcttagtgtccagctctctaaccttgga
attgtgagatctctgaggacaaagcagcagatacaacctcagaaaaagtctgtctacatt
gaattgggatctgattcttctgaagatacagttaataaggccagttattgcagtgtagga
gaccatgaattggtagaaatcacccctcaaggagccaaggctgaagccagtttgaatcct
gcaaaaaaggctgcttgtgagttttctgagaaggacataacaaaggctgaacatcatcaa
ttcagtaataaagatttgaccaccactgagaaacatgaaactgagaagcatccagaaaag
tatcagggtgaagcagcatctgagtatgagagtgaaacaagcctctctgaagactgtttg
gggctgtcctctcagagcgatatcttaaccactcagcagagggataccatgcaagacaac
ctgctgaagatccagcaggaaatggccgaactggaagctgtgttagagcagcacgggagc
cagccttctcacagctccccttccctcatagccgattcttgtgcccctgaggacctgcta
aatctggaacaaaacacatcagacagagtattaacttcagagaaaagtagtgaatatcct
atacgccagaatccagaaagcctttctgctgacaagtttcaagtatctccggattgttcc
accagtaaaaataaagaaccaggaatggaaaggtcttccccttctaaatcgcagttgtca
gataataggtggtatatgcacagccactcaagaagtcttcagaacagaaactgcccacct
caaaaggagcttgaggttgttgatgtggaagagcaacagctgactgagtctgaggcccaa
gatttaacggagcagtcttatttgccaagacaagatctagagggaaccccttacctagaa
tctggaatcagcctcttctcagatgaccctgagtctgatccctctgaagacagagcccca
gagccagctcattcttgcagcatgccaccctcagcctctgcactgaaattaccccaattt
caagtagaagaatctgccaggagtccagctgctgctcatactactaatactgcagggtat
aatgtgagggaagaaagtgtgagcagagagaagccagagttgatatcttcaacacaaaga
ggcaacaaaagaatttctatggtggcatcaggcttgaccccaaaagaatttgtgcttgtg
cacaagtttgccagaaaacatcacatcactttaactaatctaattactgaagagactact
catgtcattatgaaaacagatactgagtttgtgtgtgaacggacactgaaatattttctg
ggaattgcaggaggaagatgggtagttagctatttttgggtgacccagtctattacagaa
agaaggatgctggatgagcatgattttgaagtcagaggcgatgttgtcaatggaagaaac
catcaaggcccaaagcgagcaagagaatcccaggacaggaagatcttcaagggcttagaa
atctgttgctatggaccctttaccaatatgcccacagatcaactagagtggatggtgcat
ctgtgtggggcttctgtggtgaaggagccctcatcattcaccctcagccagggtactcaa
ccaattgtggtcgtgcagccggatgcctggacagagggcggtggcttccatgtcatcggg
cagatgtgtgaagcacctgtggtgacccgagagtgggtattggacagcgtagccctctac
cagtgccaggagctggacacctacctgataccccaggtcccacagagctgctgctga

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103008156
Entry
103008156         CDS       T03086                                 

Definition
(RefSeq) breast cancer type 1 susceptibility protein homolog
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu01524  Platinum drug resistance
bacu03440  Homologous recombination
bacu03460  Fanconi anemia pathway
bacu04120  Ubiquitin mediated proteolysis
bacu04151  PI3K-Akt signaling pathway
bacu05206  MicroRNAs in cancer
bacu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103008156
  09124 Replication and repair
   03440 Homologous recombination
    103008156
   03460 Fanconi anemia pathway
    103008156
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    103008156
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    103008156
  09162 Cancer: specific types
   05224 Breast cancer
    103008156
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103008156
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bacu01009]
    103008156
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:bacu04121]
    103008156
   03036 Chromosome and associated proteins [BR:bacu03036]
    103008156
   03400 DNA repair and recombination proteins [BR:bacu03400]
    103008156
Enzymes [BR:bacu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     103008156
Protein phosphatases and associated proteins [BR:bacu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103008156
Ubiquitin system [BR:bacu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    103008156
  Multi subunit Ring-finger type E3
   BRCC complex
    103008156
Chromosome and associated proteins [BR:bacu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     103008156
DNA repair and recombination proteins [BR:bacu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     103008156
    BRCA1-A complex
     103008156
    BRCA1-B complex
     103008156
    BRCA1-C complex
     103008156
    BRCA complex
     103008156
   FA (Fanconi anemia) pathway
    Downstream FA components
     103008156
SSDB
Motif
Pfam: BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_2 zf-RING_UBOX zf-RING_5 zf-Nse BRCT_2 zf-RING_6 zf-RING_10 Prok-RING_4 zf-ANAPC11 zf-rbx1 zf-RING_4
Other DBs
NCBI-GeneID: 103008156
NCBI-ProteinID: XP_007177805
UniProt: A0A383ZRU2
LinkDB
Position
Un
AA seq 758 aa
MDFSADHVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNDITRRSLQESTRFSQLVEEVLKVIHAFELDTGLQIANSYNFSKKENNSPEHLKE
EVSIIQSMGYRNRAKRLRQSAPENPTLQETSLSVQLSNLGIVRSLRTKQQIQPQKKSVYI
ELGSDSSEDTVNKASYCSVGDHELVEITPQGAKAEASLNPAKKAACEFSEKDITKAEHHQ
FSNKDLTTTEKHETEKHPEKYQGEAASEYESETSLSEDCLGLSSQSDILTTQQRDTMQDN
LLKIQQEMAELEAVLEQHGSQPSHSSPSLIADSCAPEDLLNLEQNTSDRVLTSEKSSEYP
IRQNPESLSADKFQVSPDCSTSKNKEPGMERSSPSKSQLSDNRWYMHSHSRSLQNRNCPP
QKELEVVDVEEQQLTESEAQDLTEQSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAP
EPAHSCSMPPSASALKLPQFQVEESARSPAAAHTTNTAGYNVREESVSREKPELISSTQR
GNKRISMVASGLTPKEFVLVHKFARKHHITLTNLITEETTHVIMKTDTEFVCERTLKYFL
GIAGGRWVVSYFWVTQSITERRMLDEHDFEVRGDVVNGRNHQGPKRARESQDRKIFKGLE
ICCYGPFTNMPTDQLEWMVHLCGASVVKEPSSFTLSQGTQPIVVVQPDAWTEGGGFHVIG
QMCEAPVVTREWVLDSVALYQCQELDTYLIPQVPQSCC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggatttttctgcggatcacgttgaagaagtacaaaatgtccttaatgctatgcagaaa
atcttagagtgtccaatctgtctggagttgatcaaagagcctgtttccacaaagtgtgat
cacatattttgcaaattttgtatgctgaaacttctcaaccagaagaaagggccttcacag
tgtcctttgtgtaagaatgatataaccagaagaagcctacaagaaagtacaagatttagt
cagcttgttgaagaggtattgaaggtcattcatgcttttgagcttgacacaggattgcag
attgcaaacagttataacttttcaaaaaaggaaaataactctcctgagcatctgaaggag
gaagtttctatcattcaaagtatgggctaccgaaaccgggccaaaagacttcgacagagt
gcacctgaaaatcctaccttgcaggaaaccagtcttagtgtccagctctctaaccttgga
attgtgagatctctgaggacaaagcagcagatacaacctcagaaaaagtctgtctacatt
gaattgggatctgattcttctgaagatacagttaataaggccagttattgcagtgtagga
gaccatgaattggtagaaatcacccctcaaggagccaaggctgaagccagtttgaatcct
gcaaaaaaggctgcttgtgagttttctgagaaggacataacaaaggctgaacatcatcaa
ttcagtaataaagatttgaccaccactgagaaacatgaaactgagaagcatccagaaaag
tatcagggtgaagcagcatctgagtatgagagtgaaacaagcctctctgaagactgtttg
gggctgtcctctcagagcgatatcttaaccactcagcagagggataccatgcaagacaac
ctgctgaagatccagcaggaaatggccgaactggaagctgtgttagagcagcacgggagc
cagccttctcacagctccccttccctcatagccgattcttgtgcccctgaggacctgcta
aatctggaacaaaacacatcagacagagtattaacttcagagaaaagtagtgaatatcct
atacgccagaatccagaaagcctttctgctgacaagtttcaagtatctccggattgttcc
accagtaaaaataaagaaccaggaatggaaaggtcttccccttctaaatcgcagttgtca
gataataggtggtatatgcacagccactcaagaagtcttcagaacagaaactgcccacct
caaaaggagcttgaggttgttgatgtggaagagcaacagctgactgagtctgaggcccaa
gatttaacggagcagtcttatttgccaagacaagatctagagggaaccccttacctagaa
tctggaatcagcctcttctcagatgaccctgagtctgatccctctgaagacagagcccca
gagccagctcattcttgcagcatgccaccctcagcctctgcactgaaattaccccaattt
caagtagaagaatctgccaggagtccagctgctgctcatactactaatactgcagggtat
aatgtgagggaagaaagtgtgagcagagagaagccagagttgatatcttcaacacaaaga
ggcaacaaaagaatttctatggtggcatcaggcttgaccccaaaagaatttgtgcttgtg
cacaagtttgccagaaaacatcacatcactttaactaatctaattactgaagagactact
catgtcattatgaaaacagatactgagtttgtgtgtgaacggacactgaaatattttctg
ggaattgcaggaggaagatgggtagttagctatttttgggtgacccagtctattacagaa
agaaggatgctggatgagcatgattttgaagtcagaggcgatgttgtcaatggaagaaac
catcaaggcccaaagcgagcaagagaatcccaggacaggaagatcttcaagggcttagaa
atctgttgctatggaccctttaccaatatgcccacagatcaactagagtggatggtgcat
ctgtgtggggcttctgtggtgaaggagccctcatcattcaccctcagccagggtactcaa
ccaattgtggtcgtgcagccggatgcctggacagagggcggtggcttccatgtcatcggg
cagatgtgtgaagcacctgtggtgacccgagagtgggtattggacagcgtagccctctac
cagtgccaggagctggacacctacctgataccccaggtcccacagagctgctgctga

DBGET integrated database retrieval system