KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005335
Entry
103005335         CDS       T03086                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin 3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu04060  Cytokine-cytokine receptor interaction
bacu04151  PI3K-Akt signaling pathway
bacu04210  Apoptosis
bacu04630  JAK-STAT signaling pathway
bacu04640  Hematopoietic cell lineage
bacu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103005335 (IL3RA)
   04151 PI3K-Akt signaling pathway
    103005335 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103005335 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103005335 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103005335 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005335 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:bacu04050]
    103005335 (IL3RA)
   04090 CD molecules [BR:bacu04090]
    103005335 (IL3RA)
Cytokine receptors [BR:bacu04050]
 Interleukin receptor families
  IL3 receptor family
   103005335 (IL3RA)
CD molecules [BR:bacu04090]
 Proteins
  103005335 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind CBM_26 Y_Y_Y
Other DBs
NCBI-GeneID: 103005335
NCBI-ProteinID: XP_007173903
UniProt: A0A383ZFG7
LinkDB
Position
Un
AA seq 391 aa
MAFVWLAVFLVAFLVPVSGLLPLDHDSYPIDVSDPDPPIKNLRMEPERKRLTWDLHGNVS
EIMCFINSKAFTKAWKSTYCSIPHLSCQATNYSIMVTKGQPFSTWIQYPSQEGNPRAAAE
NLTCWVHDVDFLTCSWAVGREAPRDVQYSLYLENLDSYEKWPCSQYTADEQGTNVQCRFH
NISVLSKDQTRFLVNGTSSDSKIPCSETSDKLAKIEVLAAPNVTSRWCNQSYLFMQWQVK
SHLNHDLKYELKMQKGTEPAYREEIYKAFLELNNPGTYTVRVRARDATFSHYKPWGPWSV
PQHFVCEDEEGARLPVWLTSLLIALGTLLIAVGFVLLFCRFSVMQKLFPPIPHMKDRING
KLQNGRTMTWDPDQDSQEECPVAEVQVLGET
NT seq 1176 nt   +upstreamnt  +downstreamnt
atggctttcgtctggctggcagtgttcctggtggcgttcctggtgcccgtctccggcctg
ctgccactggaccacgactcataccctatagacgtttccgatccagacccgccgattaag
aacctaaggatggagccagaaagaaaaagattgacctgggacctccatggaaacgtttcc
gaaattatgtgtttcatcaattcaaaagctttcactaaggcatggaaaagcacgtattgc
agtattcctcacttgtcatgccaagcgacaaactacagcatcatggtgaccaaaggtcag
ccattctccacgtggattcagtatcctagtcaagaagggaatcccagggcggctgcagaa
aacctgacctgctgggttcacgacgtggatttcctgacgtgcagctgggcggtgggccgg
gaggccccgagggacgtgcagtacagtctctacctggagaacctagactcctatgagaag
tggccgtgctcccagtacacagcagatgagcaagggacaaacgtccagtgccgcttccac
aacatctctgtgttatccaaggatcaaacccgtttcctggtgaacggtaccagcagtgac
tccaaaatcccctgctcggaaacgagcgataaattagccaaaatcgaggtattagctgct
cccaacgtcactagcaggtggtgcaaccaaagctacttgttcatgcagtggcaagtgaag
agtcaccttaatcatgacttaaagtatgaacttaagatgcagaagggtacggagcccgcc
tacagagaggagatctataaagccttcttggagctgaacaatcctgggacctacacggtg
cgagtaagagccagggatgccacgttttcccattacaaaccttggggcccgtggagtgtc
ccccaacacttcgtgtgtgaggatgaggagggcgcgcgcctccccgtctggctgacgtct
ttgctgatcgcgctggggacgctgctcatcgctgtggggttcgtgctcctgttttgcagg
ttctcggtgatgcagaagctgttccctcccatccctcacatgaaagaccgcatcaacggc
aaacttcagaacggcaggacgatgacctgggaccctgaccaagacagccaggaggagtgt
ccagtggccgaggtgcaggttctgggggaaacatga

DBGET integrated database retrieval system