KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103005437
Entry
103005437         CDS       T03086                                 

Definition
(RefSeq) junction plakoglobin-like
  KO
K10056  junction plakoglobin
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05221  Acute myeloid leukemia
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103005437
   05202 Transcriptional misregulation in cancer
    103005437
  09162 Cancer: specific types
   05226 Gastric cancer
    103005437
   05221 Acute myeloid leukemia
    103005437
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103005437
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103005437
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103005437
SSDB
Motif
Pfam: Arm HEAT Cnd1 HEAT_2 Atx10homo_assoc Adaptin_N DUF3361 KAP Arm_2 PUL
Other DBs
NCBI-GeneID: 103005437
NCBI-ProteinID: XP_007177887
UniProt: A0A383ZRY6
LinkDB
Position
Un
AA seq 744 aa
MDVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGITEEDEACGRQYMLKKTTT
YTQAVPQSQGDLDYQMSTTARAKRVREAMCPGVTGEDSSLLVTQVEGQTTNLQRLAEPSQ
LLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMG
SPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVES
VLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQE
SKLIILANGGPQALVHIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHL
TSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCN
NSKNKTLVTQNSGVEALIHAILCAGDKDDITEPAICALRHLTSRHPEAEMAQNSVRLNYG
IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRH
MAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQ
RVAAGVLCELAQDKEAADTIDAEGASAPLMELLHSHNEGTATYAAAVLFRISEDKNPDYR
KRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDMPLDPLEMHMDMD
GDYPIDTYSDGLRPPYPTADHMLA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggacgtgatgaacctcatcgaacaacccatcaaggtgaccgagtggcaacagacgtac
acctacgactcgggcatccactcgggggtcaatacctgcgtgccctcggtcagcagcaaa
ggcatcacggaggaggacgaggcctgtgggcgccagtacatgctcaagaagaccaccacc
tacacccaggcggtgccccagagccaaggtgacctggattaccagatgtccacaacagcc
agagccaagcgggtgcgggaggccatgtgtcctggtgtgacaggagaggacagctccctg
ctggtcacccaggtggagggacagaccaccaacctgcagcggctggccgagccatcccag
ctcctgaagtcagccatcgtgcatctcatcaactaccaggacgacgccgagctggccacc
cgggcccttcctgagctcaccaaactgctcaacgatgaggacccggtggtggtgaccaag
gcggccatgatcgtgaaccagctgtcgaagaaggaggcgtctcggcgggcgctgatgggc
tcgccccagctggtagcagccgtcgtgcgcaccatgcagaacaccagcgacctggacaca
gcccgctgtaccaccagcatccttcacaacctctctcaccaccgcgaggggctgcttgcc
atcttcaagtcgggcggcatccctgccctggtccgcatgctcagctcccccgtggagtcg
gtccttttctatgccatcaccacgctgcacaacctgctgctctaccaggagggcgccaag
atggcggtgcgcctggcagacgggctgcagaagatggtgcccctgctcaacaagaacaac
cccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccaggag
agcaagctcatcatcctggccaacggaggaccccaggctctcgtgcacatcatgcgcaac
tacagttacgagaagctgctctggaccaccagccgtgtgctcaaggtgctgtccgtgtgt
cccagcaataagcccgctatcgtggaggctggtgggatgcaggcgctgggcaaacacctg
acgagcaacagcccccgcctcgtgcagaactgcctctggaccctgcgcaacctctcggac
gtggccaccaagcaggagggcctggagagtgtgctgaagattctggtgaaccagctgagc
gtggatgacgtcaatgtcctcacctgtgccacgggcactctgtccaacctgacctgcaac
aacagcaagaacaagacgctggtgacgcagaacagcggcgtggaggcgctcatccatgcc
atcctgtgcgcgggtgacaaggatgacatcacagagcccgccatctgtgccctgcgccac
ctcaccagccgccaccccgaggccgagatggctcagaactccgtgcgcctcaactacggc
atcccggccatcgtcaagctgctcaaccagcccaaccagtggccactggtcaaggcaacc
atcggcctgatcaggaatctggccctgtgcccagccaaccatgccccactgcaggaggca
gcggtcattccccgcctcgtccagctgctggtcaaggcccaccaggatgcccagcgccac
atggctgcaggcacacagcagccctacacggatggcgtgaggatggaggagatcgtggaa
ggctgcaccggggccctgcacatcctcgcccgggatcccatgaaccgcatggagatcttc
cgactcaacaccatccccctgtttgtgcagctcctgtactcctcagtggagaacatccag
cgtgtggccgctggggtgctgtgcgagctggcccaggacaaggaggcggccgacaccatt
gatgctgagggggcctcagccccactcatggagctactgcactcccacaatgagggcacc
gccacctacgctgctgccgtcttgttccgcatctccgaggacaagaacccagattaccgt
aaacgtgtgtctgtggagctcaccaactccctcttcaagcacgaccctgcagcctgggag
gctgcccagagcatgatccccattaatgaaccctacgcagatgacatggatgccacctac
cgccccatgtactcgagtgacatgcccctggaccccctggagatgcacatggacatggat
ggggactaccccattgacacctacagcgacggcctcaggcccccctacccaactgcggac
cacatgctggcctag

KEGG   Balaenoptera acutorostrata scammoni (minke whale): 103007160
Entry
103007160         CDS       T03086                                 

Definition
(RefSeq) junction plakoglobin-like
  KO
K10056  junction plakoglobin
Organism
bacu  Balaenoptera acutorostrata scammoni (minke whale)
Pathway
bacu05200  Pathways in cancer
bacu05202  Transcriptional misregulation in cancer
bacu05221  Acute myeloid leukemia
bacu05226  Gastric cancer
bacu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:bacu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103007160
   05202 Transcriptional misregulation in cancer
    103007160
  09162 Cancer: specific types
   05226 Gastric cancer
    103007160
   05221 Acute myeloid leukemia
    103007160
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    103007160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bacu04147]
    103007160
Exosome [BR:bacu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103007160
SSDB
Motif
Pfam: Arm HEAT Cnd1 HEAT_2 Atx10homo_assoc Adaptin_N DUF3361 KAP Arm_2 PUL
Other DBs
NCBI-GeneID: 103007160
NCBI-ProteinID: XP_007177710
UniProt: A0A383ZRY6
LinkDB
Position
Un
AA seq 744 aa
MDVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGITEEDEACGRQYMLKKTTT
YTQAVPQSQGDLDYQMSTTARAKRVREAMCPGVTGEDSSLLVTQVEGQTTNLQRLAEPSQ
LLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALMG
SPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVES
VLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQE
SKLIILANGGPQALVHIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKHL
TSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTCN
NSKNKTLVTQNSGVEALIHAILCAGDKDDITEPAICALRHLTSRHPEAEMAQNSVRLNYG
IPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRH
MAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQ
RVAAGVLCELAQDKEAADTIDAEGASAPLMELLHSHNEGTATYAAAVLFRISEDKNPDYR
KRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDMPLDPLEMHMDMD
GDYPIDTYSDGLRPPYPTADHMLA
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggacgtgatgaacctcatcgaacaacccatcaaggtgaccgagtggcaacagacgtac
acctacgactcgggcatccactcgggggtcaatacctgcgtgccctcggtcagcagcaaa
ggcatcacggaggaggacgaggcctgtgggcgccagtacatgctcaagaagaccaccacc
tacacccaggcggtgccccagagccaaggtgacctggattaccagatgtccacaacagcc
agagccaagcgggtgcgggaggccatgtgtcctggtgtgacaggagaggacagctccctg
ctggtcacccaggtggagggacagaccaccaacctgcagcggctggccgagccatcccag
ctcctgaagtcagccatcgtgcatctcatcaactaccaggacgacgccgagctggccacc
cgggcccttcctgagctcaccaaactgctcaacgatgaggacccggtggtggtgaccaag
gcggccatgatcgtgaaccagctgtcgaagaaggaggcgtctcggcgggcgctgatgggc
tcgccccagctggtagcagccgtcgtgcgcaccatgcagaacaccagcgacctggacaca
gcccgctgtaccaccagcatccttcacaacctctctcaccaccgcgaggggctgcttgcc
atcttcaagtcgggcggcatccctgccctggtccgcatgctcagctcccccgtggagtcg
gtccttttctatgccatcaccacgctgcacaacctgctgctctaccaggagggcgccaag
atggcggtgcgcctggcagacgggctgcagaagatggtgcccctgctcaacaagaacaac
cccaagttcctggccatcaccaccgactgcctgcagctcctggcctacggcaaccaggag
agcaagctcatcatcctggccaacggaggaccccaggctctcgtgcacatcatgcgcaac
tacagttacgagaagctgctctggaccaccagccgtgtgctcaaggtgctgtccgtgtgt
cccagcaataagcccgctatcgtggaggctggtgggatgcaggcgctgggcaaacacctg
acgagcaacagcccccgcctcgtgcagaactgcctctggaccctgcgcaacctctcggac
gtggccaccaagcaggagggcctggagagtgtgctgaagattctggtgaaccagctgagc
gtggatgacgtcaatgtcctcacctgtgccacgggcactctgtccaacctgacctgcaac
aacagcaagaacaagacgctggtgacgcagaacagcggcgtggaggcgctcatccatgcc
atcctgtgcgcgggtgacaaggatgacatcacagagcccgccatctgtgccctgcgccac
ctcaccagccgccaccccgaggccgagatggctcagaactccgtgcgcctcaactacggc
atcccggccatcgtcaagctgctcaaccagcccaaccagtggccactggtcaaggcaacc
atcggcctgatcaggaatctggccctgtgcccagccaaccatgccccactgcaggaggca
gcggtcattccccgcctcgtccagctgctggtcaaggcccaccaggatgcccagcgccac
atggctgcaggcacacagcagccctacacggatggcgtgaggatggaggagatcgtggaa
ggctgcaccggggccctgcacatcctcgcccgggatcccatgaaccgcatggagatcttc
cgactcaacaccatccccctgtttgtgcagctcctgtactcctcagtggagaacatccag
cgtgtggccgctggggtgctgtgcgagctggcccaggacaaggaggcggccgacaccatt
gatgctgagggggcctcagccccactcatggagctactgcactcccacaatgagggcacc
gccacctacgctgctgccgtcttgttccgcatctccgaggacaagaacccagattaccgt
aaacgtgtgtctgtggagctcaccaactccctcttcaagcacgaccctgcagcctgggag
gctgcccagagcatgatccccattaatgaaccctacgcagatgacatggatgccacctac
cgccccatgtactcgagtgacatgcccctggaccccctggagatgcacatggacatggat
ggggactaccccattgacacctacagcgacggcctcaggcccccctacccaactgcggac
cacatgctggcctag

DBGET integrated database retrieval system